RNF19B Antibody


Immunocytochemistry/ Immunofluorescence: RNF19B Antibody [NBP2-14688] - Immunofluorescent staining of human cell line A-431 shows localization to cytosol.
Immunohistochemistry-Paraffin: RNF19B Antibody [NBP2-14688] - Staining of human lymph node shows strong cytoplasmic positivity in germinal center cells and non-germinal center cells.

Product Details

Reactivity HuSpecies Glossary
Applications ICC/IF, IHC

Order Details

RNF19B Antibody Summary

This antibody was developed against a recombinant protein corresponding to the amino acids: AQPESIRSDLESSDAQSDDVPDITSDECGSPRSHTAACPSTPRAQGAPSPSAHMNLSALAEGQTVLKPEGGEA
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
RNF19B Protein (NBP2-14688PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (82%), Rat (84%)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for RNF19B Antibody

  • IBRDC3
  • RNF19B ring finger protein 19B


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: BA
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: ELISA, IP, S-ELISA, WB
Species: Hu
Applications: BA
Species: Hu, Mu, Rt
Applications: EnzAct
Species: Hu, Mu
Applications: WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: ELISA, ICC/IF, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, WB
Species: Hu, Mu
Applications: ELISA, ICC/IF, WB
Species: Hu
Applications: IHC
Species: Hu
Applications: ELISA, ICC/IF, WB

Publications for RNF19B Antibody (NBP2-14688) (0)

There are no publications for RNF19B Antibody (NBP2-14688).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RNF19B Antibody (NBP2-14688) (0)

There are no reviews for RNF19B Antibody (NBP2-14688). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for RNF19B Antibody (NBP2-14688). (Showing 1 - 1 of 1 FAQ).

  1. I'm interested to know if your RNF19B antibody works well for western blotting applications? I am currently working on a project characterizing this protein as an interferon induced gene product, but other antibodies I have tried have not shown an interferon-induced band at the proper molecular weight.
    • Our product NBP2-14688 (RNF19B) has not yet been validated in western blot. I therefore cannot tell you with certainty if the antibody will recognize the interferon-induced band. The datasheet includes the immunogen sequence this antibody was made to, and if you would like to try it in western blot, you can qualify for our Innovator's Reward program. In exchange for your experimental review of an untested application or species, we would issue you a credit for the purchase price of the antibody. Contact us at innovators@novusbio.com for more information.

Secondary Antibodies


Isotype Controls

Additional RNF19B Products

Diseases for RNF19B Antibody (NBP2-14688)

Discover more about diseases related to RNF19B Antibody (NBP2-14688).

Pathways for RNF19B Antibody (NBP2-14688)

View related products by pathway.

Blogs on RNF19B

There are no specific blogs for RNF19B, but you can read our latest blog posts.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our RNF19B Antibody and receive a gift card or discount.


Gene Symbol RNF19B