UCK2 Antibody (1G12)

Images

 
Western Blot: UCK2 Antibody (1G12) [H00007371-M03] - Analysis of UCK2 transfected lysate using anti-UCK2 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with UCK2 rabbit polyclonal antibody.
Sandwich ELISA: UCK2 Antibody (1G12) [H00007371-M03] - Detection limit for recombinant GST tagged UCK2 is 1 ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ELISA, IP
Clone
1G12
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

UCK2 Antibody (1G12) Summary

Immunogen
UCK2 (AAH02906, 1 a.a. - 261 a.a.) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MAGDSEQTLQNHQQPNGGEPFLIGVSGGTASGKSSVCAKIVQLLGQNEVDYRQKQVVILSQDSFYRVLTSEQKAKALKGQFNFDHPDAFDNELILKTPKEITEGKTVQIPVYDFVSHSRKEETVTVYPADVVLFEGILAFYSQEVRDLFQMKLFVDTDADTRLSRRVLRDISERGRDLEQILSQYITFVKPAFEEFCLPTKKYADVIIPRGADNLVAINLIVQHIQDILNGGPSKRQTNGCLNGYTPSRKR*ASESSSRPH
Specificity
UCK2 - uridine-cytidine kinase 2 (1G12)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
UCK2
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
  • Immunoprecipitation
Application Notes
It has been used for ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for UCK2 Antibody (1G12)

  • Cytidine monophosphokinase 2
  • DKFZp686M04245
  • EC 2.7.1.48
  • Testis-specific protein TSA903
  • TSA903
  • UCK 2
  • UK
  • UMPK
  • uridine kinase
  • uridine monophosphate kinase
  • Uridine monophosphokinase 2
  • uridine-cytidine kinase 2

Background

The protein encoded by this gene catalyzes the phosphorylation of uridine monophosphate to uridine diphosphate. This is the first step in the production of the pyrimidine nucleoside triphosphates required for RNA and DNA synthesis. In addition, an allele of this gene may play a role in mediating nonhumoral immunity to Hemophilus influenzae type B. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-85896
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-34390
Species: Hu
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP
NBP1-31589
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-45397
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-46313
Species: Hu, Mk
Applications: WB, IHC, IF
NBP2-43639
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-47587
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-39019
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00005236-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IP, RNAi
NBP1-31851
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
NBP2-25147
Species: Hu, Mu, Rt, Bv, Xp
Applications: WB, Simple Western, ICC/IF
H00001806-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP1-87311
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP1-57516
Species: Hu
Applications: WB
NBP1-87404
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-19015
Species: Hu, Mu
Applications: WB, Simple Western, ELISA, ICC/IF, IP
MAB6240
Species: Hu
Applications: WB, IHC
NBP1-85740
Species: Hu, Po
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-15291
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-24750
Species: Hu, Mu, Rt, Pm
Applications: WB, IHC-P

Publications for UCK2 Antibody (H00007371-M03) (0)

There are no publications for UCK2 Antibody (H00007371-M03).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for UCK2 Antibody (H00007371-M03) (0)

There are no reviews for UCK2 Antibody (H00007371-M03). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for UCK2 Antibody (H00007371-M03) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional UCK2 Products

Bioinformatics Tool for UCK2 Antibody (H00007371-M03)

Discover related pathways, diseases and genes to UCK2 Antibody (H00007371-M03). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for UCK2 Antibody (H00007371-M03)

Discover more about diseases related to UCK2 Antibody (H00007371-M03).
 

Pathways for UCK2 Antibody (H00007371-M03)

View related products by pathway.

PTMs for UCK2 Antibody (H00007371-M03)

Learn more about PTMs related to UCK2 Antibody (H00007371-M03).

Blogs on UCK2

There are no specific blogs for UCK2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our UCK2 Antibody (1G12) and receive a gift card or discount.

Bioinformatics

Gene Symbol UCK2
Entrez
Uniprot