RNF141 Antibody (6D9)

Images

 
Western Blot: RNF141 Antibody (6D9) [H00050862-M01] - RNF141 monoclonal antibody (M01), clone 6D9 Analysis of RNF141 expression in A-431.
Immunohistochemistry-Paraffin: RNF141 Antibody (6D9) [H00050862-M01] - Analysis of monoclonal antibody to RNF141 on formalin-fixed paraffin-embedded human testis. Antibody concentration 0.3 ug/ml.
Western Blot: RNF141 Antibody (6D9) [H00050862-M01] - Analysis of RNF141 over-expressed 293 cell line, cotransfected with RNF141 Validated Chimera RNAi ( Cat # H00050862-R01V ) (Lane 2) or non-transfected control (Lane ...read more
Western Blot: RNF141 Antibody (6D9) [H00050862-M01] - RNF141 monoclonal antibody (M01), clone 6D9. Analysis of RNF141 expression in PC-12.
Western Blot: RNF141 Antibody (6D9) [H00050862-M01] - RNF141 monoclonal antibody (M01), clone 6D9. Analysis of RNF141 expression in Raw 264.7.
Western Blot: RNF141 Antibody (6D9) [H00050862-M01] - Analysis of RNF141 expression in transfected 293T cell line by RNF141 monoclonal antibody (M01), clone 6D9.Lane 1: RNF141 transfected lysate(25.5 KDa).Lane 2: ...read more
Sandwich ELISA: RNF141 Antibody (6D9) [H00050862-M01] - Detection limit for recombinant GST tagged RNF141 is approximately 0.03ng/ml as a capture antibody.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ELISA, IHC, IHC-P, S-ELISA, KD
Clone
6D9
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

RNF141 Antibody (6D9) Summary

Immunogen
RNF141 (NP_001008563, 141 a.a. ~ 229 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. LWMGRVKQLTDEEECCICMDGRADLILPCAHSFCQKCIDKWSDRHRNCPICRLQMTGANESWVVSDAPTEDDMANYILNMADEAGQPHR
Specificity
RNF141 - ring finger protein 141
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
RNF141
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
  • Knockdown Validated
  • Sandwich ELISA
  • Western Blot 1:500
Application Notes
Antibody reactive against cell lysate and recombinant protein for Western Blot. Has also been used for immunohistochemistry (paraffin), RNAi validation, and ELISA.

Reactivity Notes

Human, Mouse, & Rat. Other species not tested.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for RNF141 Antibody (6D9)

  • C3HC4-like zinc finger protein
  • MGC8715
  • ring finger protein 141
  • Zinc finger protein 230
  • ZNF230ZFP26

Background

The protein encoded by this gene contains a RING finger, a motif known to be involved in protein-DNA and protein-protein interactions. Abundant expression of this gene was found in the testicular tissue of fertile men, but was not detected in azoospermic patients. Studies of the mouse counterpart suggest that this gene may function as a testis specific transcription factor during spermatogenesis.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

255-SC/CF
Species: Hu
Applications: BA
NBP1-82884
Species: Hu, Mu
Applications: IHC, IHC-P
NBP2-80461
Species: Hu
Applications: Flow, IHC, IHC-P, WB
MAB9219
Species: Hu
Applications: CyTOF-ready, ICC, ICFlow, WB
NBP2-45881
Species: Hu
Applications: Flow, IF, IHC, WB
NBP1-30475
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, IP, WB
NBP2-49118
Species: Hu
Applications: IHC, IHC-P
AF5286
Species: Hu
Applications: WB
NB110-59723
Species: Hu, Mu, Po
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-47470
Species: Hu, Mu, Pm, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, Simple Western, WB
5334-KL
Species: Hu
Applications: BA
NBP2-94035
Species: Hu, Mu, Rt
Applications: ChIP, ICC/IF, IHC, IHC-P, WB
NBP2-22360
Species: Hu, Mu
Applications: ICC/IF, IP, WB
NBP2-82977
Species: Hu
Applications: IHC, IHC-P, WB
AF4078
Species: Hu
Applications: CyTOF-ready, IHC, ICFlow, WB
NB600-232
Species: Hu, Mu
Applications: ChIP, IHC, IHC-P, IP, WB
NB100-689
Species: Hu, Rt
Applications: IHC, IHC-Fr, IHC-P, Simple Western, WB
DPSG10
Species: Hu
Applications: ELISA

Publications for RNF141 Antibody (H00050862-M01) (0)

There are no publications for RNF141 Antibody (H00050862-M01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RNF141 Antibody (H00050862-M01) (0)

There are no reviews for RNF141 Antibody (H00050862-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for RNF141 Antibody (H00050862-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional RNF141 Products

Bioinformatics Tool for RNF141 Antibody (H00050862-M01)

Discover related pathways, diseases and genes to RNF141 Antibody (H00050862-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RNF141 Antibody (H00050862-M01)

Discover more about diseases related to RNF141 Antibody (H00050862-M01).
 

Pathways for RNF141 Antibody (H00050862-M01)

View related products by pathway.

Research Areas for RNF141 Antibody (H00050862-M01)

Find related products by research area.

Blogs on RNF141

There are no specific blogs for RNF141, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our RNF141 Antibody (6D9) and receive a gift card or discount.

Bioinformatics

Gene Symbol RNF141
Entrez
Uniprot