RNF141 Antibody (6D9) - Azide and BSA Free

Western Blot: RNF141 Antibody (6D9) [H00050862-M01] - RNF141 monoclonal antibody (M01), clone 6D9 Analysis of RNF141 expression in A-431.

Immunohistochemistry-Paraffin: RNF141 Antibody (6D9) [H00050862-M01] - Analysis of monoclonal antibody to RNF141 on formalin-fixed paraffin-embedded human testis. Antibody concentration 0.3 ug/ml.

Western Blot: RNF141 Antibody (6D9) [H00050862-M01] - Analysis of RNF141 over-expressed 293 cell line, cotransfected with RNF141 Validated Chimera RNAi ( Cat # H00050862-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with RNF141 monoclonal antibody (M01), clone 6D9 (Cat # H00050862-M01 ). GAPDH ( 36.1 kDa ) used as specificity and loading control.

Western Blot: RNF141 Antibody (6D9) [H00050862-M01] - RNF141 monoclonal antibody (M01), clone 6D9. Analysis of RNF141 expression in PC-12.

Western Blot: RNF141 Antibody (6D9) [H00050862-M01] - RNF141 monoclonal antibody (M01), clone 6D9. Analysis of RNF141 expression in Raw 264.7.

Western Blot: RNF141 Antibody (6D9) [H00050862-M01] - Analysis of RNF141 expression in transfected 293T cell line by RNF141 monoclonal antibody (M01), clone 6D9.Lane 1: RNF141 transfected lysate(25.5 KDa).Lane 2: Non-transfected lysate.

Sandwich ELISA: RNF141 Antibody (6D9) [H00050862-M01] - Detection limit for recombinant GST tagged RNF141 is approximately 0.03ng/ml as a capture antibody.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ELISA, IHC, KD
• Clone: 6D9
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

RNF141 Antibody (6D9) - Azide and BSA Free Summary

• Immunogen: RNF141 (NP_001008563, 141 a.a. ~ 229 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. LWMGRVKQLTDEEECCICMDGRADLILPCAHSFCQKCIDKWSDRHRNCPICRLQMTGANESWVVSDAPTEDDMANYILNMADEAGQPHR
• Specificity: RNF141 - ring finger protein 141
• Isotype: IgG1 Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: RNF141
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
  • Knockdown Validated
  • Sandwich ELISA
  • Western Blot 1:500
• Application Notes: Antibody reactive against cell lysate and recombinant protein for Western Blot. Has also been used for immunohistochemistry (paraffin), RNAi validation, and ELISA.

Reactivity Notes

Human, Mouse, & Rat. Other species not tested.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for RNF141 Antibody (6D9) - Azide and BSA Free

• C3HC4-like zinc finger protein
• MGC8715
• ring finger protein 141
• Zinc finger protein 230
• ZNF230ZFP26

Background

The protein encoded by this gene contains a RING finger, a motif known to be involved in protein-DNA and protein-protein interactions. Abundant expression of this gene was found in the testicular tissue of fertile men, but was not detected in azoospermic patients. Studies of the mouse counterpart suggest that this gene may function as a testis specific transcription factor during spermatogenesis.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: RNF141
• Entrez:
  • 50862(Human)
• Uniprot:
  • NP_057506.2(Human)