RNASET2 Antibody

Images

 
Western Blot: RNASET2 Antibody [H00008635-B01P] - Analysis of RNASET2 expression in transfected 293T cell line by RNASET2 polyclonal antibody. Lane 1: RNASET2 transfected lysate(28.16 KDa). Lane 2: Non-transfected ...read more

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

RNASET2 Antibody Summary

Immunogen
RNASET2 (NP_003721.2, 1 a.a. - 256 a.a.) full-length human protein. MRPAALRGALLGCLCLALLCLGGADKRLRDNHEWKKLIMVQHWPETVCEKIQNDCRDPPDYWTIHGLWPDKSEGCNRSWPFNLEEIKDLLPEMRAYWPDVIHSFPNRSRFWKHEWEKHGTCAAQVDALNSQKKYFGRSLELYRELDLNSVLLKLGIKPSINYYQVADFKDALARVYGVIPKIQCLPPSQDEEVQTIGQIELCLTKQDQQLQNCTEPGEQPSPKQEVWLANGAAESRGLRVCEDGPVFYPPPKKTKH
Isotype
IgG
Clonality
Polyclonal
Host
Mouse
Gene
RNASET2
Purity
Protein G purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
Application Notes
It has been used for WB.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein G purified

Notes

Quality control test: Antibody reactive against mammalian transfected lysate.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for RNASET2 Antibody

  • EC 3.1.27.-
  • EC 3.1.27.1
  • FLJ10907
  • FLJ42372
  • Ribonuclease 6
  • ribonuclease T2
  • RNASE6PLbA514O12.3

Background

This ribonuclease gene is a novel member of the Rh/T2/S-glycoprotein class of extracellular ribonucleases. It is a single copy gene that maps to 6q27, a region associated with human malignancies and chromosomal rearrangement. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-89285
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-56762
Species: Hu
Applications: WB, ICC/IF
NB120-2941
Species: Hu, Mu, Rt, Bv, Pm
Applications: WB, IHC, IHC-P
NBP1-69668
Species: Hu
Applications: WB
NBP2-07087
Species: Hu
NBP2-52555
Species: Hu, Mu
Applications: WB, ELISA, Flow, IHC, IHC-P, CyTOF-ready, ICC, IF
NBP2-14871
Species: Hu, Mu
Applications: WB, ICC/IF
NB120-2860
Species: Hu, Mu, Rt, Ba, Bv, Ch
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, ICC, IF
NBP1-98474
Species: Hu
Applications: WB
NBP1-81831
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
MAB6534
Species: Hu
Applications: WB, ELISA
NBP1-91865
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB600-648
Species: Bv
Applications: WB, ELISA, IP
NBP2-14081
Species: Hu
Applications: IHC, IHC-P
AF4210
Species: Hu
Applications: WB, IHC
NBP2-29931
Species: Hu
Applications: WB, Flow, IHC-P
NBP2-34234
Species: Hu
Applications: ICC/IF, IHC-Fr, IHC-P
H00008635-B01P
Species: Hu
Applications: WB

Publications for RNASET2 Antibody (H00008635-B01P) (0)

There are no publications for RNASET2 Antibody (H00008635-B01P).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RNASET2 Antibody (H00008635-B01P) (0)

There are no reviews for RNASET2 Antibody (H00008635-B01P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for RNASET2 Antibody (H00008635-B01P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional RNASET2 Products

Bioinformatics Tool for RNASET2 Antibody (H00008635-B01P)

Discover related pathways, diseases and genes to RNASET2 Antibody (H00008635-B01P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RNASET2 Antibody (H00008635-B01P)

Discover more about diseases related to RNASET2 Antibody (H00008635-B01P).
 

Pathways for RNASET2 Antibody (H00008635-B01P)

View related products by pathway.

PTMs for RNASET2 Antibody (H00008635-B01P)

Learn more about PTMs related to RNASET2 Antibody (H00008635-B01P).

Blogs on RNASET2

There are no specific blogs for RNASET2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our RNASET2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol RNASET2
Uniprot