Rit2 Antibody - BSA Free Summary
Immunogen |
This antibody has been engineered to specifically recognize the recombinant protein Rit2 using the following amino acid sequence: LVREIRKKESMPSLMEKKLKRKDSLWKKLKGSLKKKR |
Isotype |
IgG |
Clonality |
Polyclonal |
Host |
Rabbit |
Gene |
RIT2 |
Purity |
Affinity purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Dilutions |
- Immunocytochemistry/ Immunofluorescence 0.25-2 µg/ml
|
Application Notes |
For ICC/IF, we recommend using a combination of PFA and Triton X-100. This will give you the optimal results for your experiments. |
Packaging, Storage & Formulations
Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Buffer |
PBS, pH 7.2, 40% glycerol |
Preservative |
0.02% Sodium Azide |
Purity |
Affinity purified |
Alternate Names for Rit2 Antibody - BSA Free
Background
RIT2 is a gene that codes for a protein which binds and exchanges GTP and GDP, and has two isoforms with lengths of 217 and 153 amino acids, with weights of approximately 25 and 17 kDa, respectively. Current studies are being done on diseases and disorders relating to this gene including neuronitis, ehrlichiosis, cryoglobulinemia, hepatitis, Parkinson's disease, and schizophrenia. RIT2 has been shown to have interactions with CALM1, CALM2, CALM3, RLF, and HRAS in pathways such as the Trk receptor signaling, signaling to NGF, and signaling to ERKs pathways.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow
Species: Hu, Mu, Rt
Applications: IHC, Simple Western, WB
Species: Hu, Mu
Applications: ELISA, ICC/IF, IP, WB
Species: Hu, Mu, Po, Rt, Sh
Applications: Flow, ICC/IF, IHC, IHC-P, PEP-ELISA, WB
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IP, WB
Species: Hu, Mu
Applications: ICC/IF, WB
Species: Bv, Hu, Po
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Mu
Applications: WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: ICC, Simple Western, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P
Species: Bv, Eq, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, PLA, WB
Species: Hu
Applications: ICC/IF
Publications for Rit2 Antibody (NBP3-25106) (0)
There are no publications for Rit2 Antibody (NBP3-25106).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Rit2 Antibody (NBP3-25106) (0)
There are no reviews for Rit2 Antibody (NBP3-25106).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for Rit2 Antibody (NBP3-25106) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional Rit2 Products
Research Areas for Rit2 Antibody (NBP3-25106)
Find related products by research area.
|
Blogs on Rit2