RIMS Binding Protein 2 Antibody

Images

 
Immunohistochemistry-Paraffin: RIMS Binding Protein 2 Antibody [NBP2-30643] - Staining of human cerebral cortex shows strong cytoplasmic positivity in neuronal cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

RIMS Binding Protein 2 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: RVDNITQISAQLSWLPTNSNYSHVIFLNEEEFDIVKAARYKYQFFNLRPNMAYKVKVLAKPHQMPWQLPLEQREKKEAFVEFSTLP
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (95%), Rat (95%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
RIMBP2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
RIMS Binding Protein 2 Protein (NBP2-30643PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for RIMS Binding Protein 2 Antibody

  • KIAA0318
  • RBP2
  • RIM Binding Protein 2
  • RIMBP2
  • RIM-BP2
  • RIMS-Binding Protein 2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-00637
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB110-40499
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP, PLA
NBP1-26616
Species: Hu
Applications: WB, IP
NB300-537
Species: Hu, Mu, Rt, Bv, Rb
Applications: WB, ChIP, Flow, GS, ICC/IF, IHC, IHC-P, IP
NB100-97821
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP, IF
NB500-171
Species: Hu, Mu, Rt, Xp, Ye
Applications: WB, ChIP, ICC/IF, IHC, IHC-P
NB300-539
Species: Hu, Mu, Rt, Bv, Ca, Ch, Fe, Pm, Rb
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-87695
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF4146
Species: Hu, Mu, Rt
Applications: WB, IHC
NBP2-50444
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC
NBP2-55541
Species: Hu
Applications: WB, ICC/IF
NB100-56598
Species: Hu, Mu
Applications: WB, IHC, IHC-Fr, IHC-P
NB110-41487
Species: Hu, Mu, Rt, Bv, Ze
Applications: WB, ICC/IF
NBP1-71701
Species: Hu, Mu
Applications: WB
NB200-322
Species: Hu, Mu, Rt
Applications: WB, IHC-Fr
NB110-83978
Species: Hu, Mu, Rt, Bv
Applications: WB, ChIP, IHC, IHC-P
NB100-61070
Species: Hu
Applications: WB (-), IP
NBP2-30643
Species: Hu, Mu, Rt
Applications: IHC, IHC-P

Publications for RIMS Binding Protein 2 Antibody (NBP2-30643) (0)

There are no publications for RIMS Binding Protein 2 Antibody (NBP2-30643).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RIMS Binding Protein 2 Antibody (NBP2-30643) (0)

There are no reviews for RIMS Binding Protein 2 Antibody (NBP2-30643). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for RIMS Binding Protein 2 Antibody (NBP2-30643) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional RIMS Binding Protein 2 Products

Bioinformatics Tool for RIMS Binding Protein 2 Antibody (NBP2-30643)

Discover related pathways, diseases and genes to RIMS Binding Protein 2 Antibody (NBP2-30643). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on RIMS Binding Protein 2

There are no specific blogs for RIMS Binding Protein 2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our RIMS Binding Protein 2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol RIMBP2
Uniprot