RIC8B Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: RIC8B Antibody [NBP2-13232] - Immunofluorescent staining of human cell line A-431 shows localization to cytosol & centrosome.
Immunohistochemistry-Paraffin: RIC8B Antibody [NBP2-13232] - Staining of human colon shows strong granular cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

RIC8B Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: RVLRDYSDKHRATFKFESTDEDKRKKLCEGIFKVLIKDIPTTCQVSCLEV LRILSRDKKVLVPVTTKENMQILLRLAKLNELDDSLEKVSEFPVIVE
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (93%), Rat (90%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
RIC8B
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:500-1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. For Immunofluorescence, Fixation/Permeabilization: PFA/Triton X-100.
Control Peptide
RIC8B Protein (NBP2-13232PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for RIC8B Antibody

  • Brain synembrin
  • hSyn
  • Protein Ric-8B
  • RIC8
  • RIC8B resistance to inhibitors of cholinesterase 8 homolog B (C. elegans)
  • synembryn
  • synembryn-B

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF6260
Species: Hu
Applications: WB
NBP1-52556
Species: Hu, Mu, Po, Bt, Bv, Ca, Mk, Pm, Rb
Applications: IHC-P
NBP1-85727
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-21577
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
H00056731-M02
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP2-47304
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89489
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF9024
Species: Mu, Rt
Applications: WB, IHC
NBL1-15615
Species: Hu
NBP1-32521
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-16699
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB100-2594
Species: Hu, Mu
Applications: WB, ChIP, IHC-P, IP, PLA
NBP1-90015
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-31029
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for RIC8B Antibody (NBP2-13232) (0)

There are no publications for RIC8B Antibody (NBP2-13232).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RIC8B Antibody (NBP2-13232) (0)

There are no reviews for RIC8B Antibody (NBP2-13232). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for RIC8B Antibody (NBP2-13232) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional RIC8B Products

Bioinformatics Tool for RIC8B Antibody (NBP2-13232)

Discover related pathways, diseases and genes to RIC8B Antibody (NBP2-13232). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Pathways for RIC8B Antibody (NBP2-13232)

View related products by pathway.

PTMs for RIC8B Antibody (NBP2-13232)

Learn more about PTMs related to RIC8B Antibody (NBP2-13232).

Blogs on RIC8B

There are no specific blogs for RIC8B, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our RIC8B Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol RIC8B