We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

RHOT2 Recombinant Protein Antigen

Images

 
There are currently no images for RHOT2 Protein (NBP1-88982PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

RHOT2 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human RHOT2.

Source: E. coli

Amino Acid Sequence: RSCLGHLGYLGYPTLCEQDQAHAITVTREKRLDQEKGQTQRSVLLCKVVGACGVGKSAFLQAFLGRGLGHQDTREQPPGYAIDTVQVNGQEKYLILC

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
RHOT2
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-88982.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
28 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for RHOT2 Recombinant Protein Antigen

  • ARHT2
  • C16orf39
  • chromosome 16 open reading frame 39
  • EC 3.6.5
  • EC 3.6.5.-
  • hMiro-2
  • MIRO-2mitochondrial Rho 2
  • mitochondrial Rho GTPase 2
  • Ras homolog gene family member T2
  • ras homolog gene family, member T2
  • RASL

Background

RHOT2 is a gene that codes for a protein that is 618 amino acids long and weighs approximately 68 kDa and has a shorter isoform that is 213 amino acids long and weighs approximately 23 kDa. The protein that RHOT2 codes for is a mitochondrial GTPase that is involved in mitochondrial trafficking as well as the control of the subcellular distribution of mitochondria. Current research is being done on diseases and disorders linked to this gene including hypoxia. RHOT2 has been shown to have interactions with ZFYVE9, RYK, TRAK1, BECN1, and CLN3 in pathways such as the Rho GTPase cycle and signal transduction pathways.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-59021
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, IP, WB
NBP3-45743
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IP, WB
H00009927-M03
Species: Hu, Rt
Applications: ELISA, IHC,  IHC-P, RNAi, WB
NBP1-56761
Species: Hu
Applications: WB
NBP1-58359
Species: Hu
Applications: IHC,  IHC-P, WB
NBP2-25160
Species: Bv, Ca, Eq, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, WB
NB100-1919
Species: Ca, Fe, Hu, Mu, Pm, Rt
Applications: ICC/IF, IHC,  IHC-P, IP, WB
NBP1-89284
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, KD, WB
NB100-57493
Species: Hu, Mu
Applications: IP, WB
NBP1-85664
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-92630
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
NB100-105
Species: Bv, Ca, Fe, Ma, Hu, Pm, Mu, Po, Pm, Rb, Rt, Sh, Xp
Applications: ChIP, ChIP, ELISA, Flow, GS, IA, IB, ICC/IF, IHC-FrFl, IHC, IHC-Fr,  IHC-P, IP, In vitro, KD, KO, LA, PLA, Simple Western, TCS, WB
NBP2-54955
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
NB100-2357
Species: Hu, Mu, Pm
Applications: ChIP, IHC,  IHC-P, IP, WB
BC100-494
Species: Hu, Mu, Rb, Rt
Applications: EM, IB, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, KD, KO, PEP-ELISA, PAGE, WB
NBP2-47466
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
H00055669-M04
Species: Hu, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IP, KD, WB
NBP1-88982PEP
Species: Hu
Applications: AC

Publications for RHOT2 Protein (NBP1-88982PEP) (0)

There are no publications for RHOT2 Protein (NBP1-88982PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RHOT2 Protein (NBP1-88982PEP) (0)

There are no reviews for RHOT2 Protein (NBP1-88982PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for RHOT2 Protein (NBP1-88982PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional RHOT2 Products

Array NBP1-88982PEP

Research Areas for RHOT2 Protein (NBP1-88982PEP)

Find related products by research area.

Blogs on RHOT2

There are no specific blogs for RHOT2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our RHOT2 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol RHOT2