We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

RhoG Recombinant Protein Antigen

Images

 
There are currently no images for RhoG Protein (NBP1-88832PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

RhoG Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human RHOG.

Source: E. coli

Amino Acid Sequence: KDLRAQPDTLRRLKEQGQAPITPQQGQALAKQIHAVRYL

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
RHOG
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-88832.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
22 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for RhoG Recombinant Protein Antigen

  • ARHGMGC125835
  • MGC125836
  • ras homolog gene family, member G (rho G)
  • RhoG
  • rho-related GTP-binding protein RhoG

Background

RhoG, also known as Rho-related GTP-binding protein RhoG, is a 21kDa 191 amino acid protein. RhoG plays a significant part in cell migration. RhoG has been researched in relation to Tangier disease, intrahepatic cholangiocarcinoma, shigellosis, cholangiocarcinoma, cholesterol and thyroiditis. RhoG has been linked to the axon guidance, cell adhesion, phagocytosis, cell motility and cell growth pathways where it interacts with VAV1, VAV2, ELMO1, MAP3K11 and ARHGDIG.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-91266
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, WB
AF887
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
NBP2-67895
Species: Hu, Mu, Rt
Applications: Flow, IHC,  IHC-P, IP, WB
NBP2-25160
Species: Bv, Ca, Eq, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, WB
NBP1-58359
Species: Hu
Applications: IHC,  IHC-P, WB
NB100-91273
Species: Hu, Mu, Pm, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
AF6260
Species: Hu
Applications: WB
NB110-68800
Species: Hu, Mu, Pm
Applications: ICC/IF, WB
NBP1-85727
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
NBP1-30945
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-33645
Species: Hu, Mu, Rt, Ze
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-21577
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, IP, KD, WB
NB100-879
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, PEP-ELISA, WB
H00056731-M02
Species: Hu
Applications: ELISA, ICC/IF, WB
NBP1-90256
Species: Hu
Applications: ChIP-EXO-SEQ, ICC/IF, IHC,  IHC-P, WB
NBP2-73890
Species: Ca, Hu, Pm, Mu, Pm, Rt
Applications: CyTOF-ready, Flow, WB
NBP2-32058
Species: Hu
Applications: IHC,  IHC-P, WB
NBP1-33449
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-88832PEP
Species: Hu
Applications: AC

Publications for RhoG Protein (NBP1-88832PEP) (0)

There are no publications for RhoG Protein (NBP1-88832PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RhoG Protein (NBP1-88832PEP) (0)

There are no reviews for RhoG Protein (NBP1-88832PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for RhoG Protein (NBP1-88832PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional RhoG Products

Research Areas for RhoG Protein (NBP1-88832PEP)

Find related products by research area.

Blogs on RhoG

There are no specific blogs for RhoG, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our RhoG Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol RHOG