Rhodopsin Antibody


Immunohistochemistry-Paraffin: Rhodopsin Antibody [NBP2-55553] - Staining of human retina shows strong cytoplasmic positivity in rod segments.

Product Details

Reactivity Hu, Mu, RtSpecies Glossary
Applications IHC, IHC-P

Order Details

Rhodopsin Antibody Summary

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: MNGTEGPNFYVPFSNATGVVRSPFEYPQYYLAEPWQFS
Specificity of human Rhodopsin antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (95%), Rat (95%). Backed by our 100% Guarantee.
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Rhodopsin Recombinant Protein Antigen (NBP2-55553PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Affinity purified

Alternate Names for Rhodopsin Antibody

  • MGC138309
  • OPN2MGC138311
  • opsin 2, rod pigment
  • opsin-2
  • retinitis pigmentosa 4, autosomal dominant
  • rhodopsin
  • RP4


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt, Pm
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC, IHC-P, IP
Species: Hu, Mu, Rt, Ca, Pm, Rb
Applications: WB, ICC/IF
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Mu
Applications: Flow, IA, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, ICC, KO
Species: Hu, Bv
Applications: WB, ICC/IF, IHC, IHC-Fr, IP
Species: Hu, Mu
Applications: WB, ICC/IF, IHC-P
Species: Hu, Mu
Applications: WB, Flow, CyTOF-ready, ICC
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Pm, Pm
Applications: IHC, IHC-P
Species: Hu, Pm
Applications: IHC, IHC-P, ICC
Species: Hu, Rt, Pm
Applications: IHC, IHC-P
Species: Hu, Mu, Rt
Applications: IHC, IHC-P

Publications for Rhodopsin Antibody (NBP2-55553) (0)

There are no publications for Rhodopsin Antibody (NBP2-55553).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Rhodopsin Antibody (NBP2-55553) (0)

There are no reviews for Rhodopsin Antibody (NBP2-55553). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for Rhodopsin Antibody (NBP2-55553) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Other Available Formats

Additional Rhodopsin Products

Bioinformatics Tool for Rhodopsin Antibody (NBP2-55553)

Discover related pathways, diseases and genes to Rhodopsin Antibody (NBP2-55553). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Rhodopsin Antibody (NBP2-55553)

Discover more about diseases related to Rhodopsin Antibody (NBP2-55553).

Pathways for Rhodopsin Antibody (NBP2-55553)

View related products by pathway.

PTMs for Rhodopsin Antibody (NBP2-55553)

Learn more about PTMs related to Rhodopsin Antibody (NBP2-55553).

Research Areas for Rhodopsin Antibody (NBP2-55553)

Find related products by research area.

Blogs on Rhodopsin.

Vision Infographic: Do you see how I see?
Vision involves several parts of the eye processing light which send signals to the brain via the optic nerve to process information. Learn more about the vision process and related ocular proteins in the infographic below. Novus Biological...  Read full blog post.

Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our Rhodopsin Antibody and receive a gift card or discount.


Gene Symbol RHO