Home » Rhodopsin » Rhodopsin Antibodies » Rhodopsin Antibody

Rhodopsin Antibody

 Submit a Review

Images

 
(
Enlarge)
Immunohistochemistry-Paraffin: Rhodopsin Antibody [NBP2-55553] - Staining of human retina shows strong cytoplasmic positivity in rod segments.
Immunohistochemistry-Paraffin: Rhodopsin Antibody [NBP2-55553] - Staining of human retina shows strong cytoplasmic positivity in rod segments.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

100% Guarantee on every product

Rhodopsin Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: MNGTEGPNFYVPFSNATGVVRSPFEYPQYYLAEPWQFS
Specificity
Specificity of human Rhodopsin antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (95%), Rat (95%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
RHO
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Rhodopsin Recombinant Protein Antigen (NBP2-55553PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for Rhodopsin Antibody

  • CSNBAD1
  • MGC138309
  • OPN2MGC138311
  • opsin 2, rod pigment
  • opsin-2
  • retinitis pigmentosa 4, autosomal dominant
  • rhodopsin
  • RP4

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

LIGHT/TNFSF14
[Unconjugated]
664-LI/CF
1 µg/lane of Recombinant Human LIGHT/TNFSF14 (Catalog # 664-LI/CF) was resolved with SDS-PAGE under reducing (R) conditions and visualized by silver staining, showing a band at 25 kDa.
Recombinant Human LIGHT/TNFSF14 (Catalog # 664-LI/CF) stimulates cell proliferation in HUVEC human umbilical vein endothelial cells. The ED50 is 1-4 ng/mL.
(16 Publications)
Species: Hu
RhoA Antibody
NB100-91273
Western Blot: RhoA Antibody [NB100-91273] - Rat spinal cord lysate using Rabbit antibody to Transforming protein RhoA: whole serum at 1:2000 dilution. One single band is detected.
Immunocytochemistry/Immunofluorescence: RhoA Antibody [NB100-91273] - Rat trigeminal at 1:500 dilution using Rabbit antibody to Transforming protein RhoA: whole serum (NB100-91273, in red), Sheep antibody to extracellular, N-terminal part of Sortilin: whole serum (NB100-98771, in green), DAPI counter stained appearing in blue.
Immunohistochemistry: RhoA Antibody [NB100-91273] - IHC on rat brain (paraffin sections) using Rabbit antibody to RhoA at a concentration of 15 ug/ml, incubated overnight and developed with DAB Ni.
(1 Review)
(3 Publications)
Species: Hu, Mu, Rt, Pm
Applications: WB, ICC/IF, IHC, IHC-P
AKT [p Ser473]
Antibody - Pan Specif
AF887
Western blot shows lysates of NIH‑3T3 mouse embryonic fibroblast cell line untreated (-) or treated (+) with 100 ng/mL Human PDGF (Catalog # 120‑HD) for 15 minutes and MCF‑7 human breast cancer cell line untreated or treated with 100 ng/mL Recombinant Human IGF-1 (Catalog # 291‑G1) for 15 minutes. PVDF membrane was probed with 0.5 µg/mL of Rabbit Anti-Human/Mouse/Rat Phospho-Akt (S473) Pan Specific Antigen Affinity-purified Polyclonal Antibody (Catalog # AF887), followed by HRP-conjugated Anti-Rabbit IgG Secondary Antibody (Catalog # HAF008). A specific band was detected for Phospho-Akt (S473) Pan Specific at approximately 60 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
Simple Western lane view shows lysates of MCF‑7 human breast cancer cell line and A549 human lung carcinoma cell line untreated (-) or treated (+) with 100 ng/mL Recombinant Human IGF‑I (Catalog # 291-G1) for 15 minutes, loaded at 0.2 mg/mL. A specific band was detected for Phospho-Akt (S473) at approximately 60 kDa (as indicated) using 5 µg/mL of Rabbit Anti-Human/Mouse/Rat Phospho-Akt (S473) Pan Specific Antigen Affinity-purified Polyclonal Antibody (Catalog # AF887). This experiment was conducted under reducing conditions and using the 12-230 kDa separation system.
Serum-starved MCF‑7 human breast cancer cells were unstimulated (light orange filled histogram) or activated with 100 ng/mL Recombinant human IGF-1 (Catalog # 291-G1, dark orange filled histogram) for 15 minutes, then stained with Rabbit Anti-Human/Mouse/Rat Phospho‑Akt (S473) Antigen Affinity‑purified Polyclonal Antibody (Catalog # AF887) or control antibody (Catalog # AB-105-C, open histogram), followed by Allophycocyanin-conjugated Anti-Rabbit IgG Secondary Antibody (Catalog # F0111). To facilitate intracellular staining, cells were fixed with paraformaldehyde and permeabilized with saponin.
(23 Publications)
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow
CDC42 Antibody
(JJ086-04)
NBP2-67895
Western Blot: CDC42 Antibody (JJ086-04) [NBP2-67895] - Analysis of CDC42 on different lysates using anti-CDC42 antibody at 1/1,000 dilution. Positive control: Lane 1: Hela Lane 2: Jurkat Lane 3: HepG2
Immunohistochemistry-Paraffin: CDC42 Antibody (JJ086-04) [NBP2-67895] - Analysis of paraffin-embedded mouse pancreas tissue using anti-CDC42 antibody. Counter stained with hematoxylin.
Flow Cytometry: CDC42 Antibody (JJ086-04) [NBP2-67895] - Analysis of Hela cells with CDC42 antibody at 1/50 dilution (red) compared with an unlabelled control (cells without incubation with primary antibody; black). Alexa Fluor 488-conjugated goat anti rabbit IgG was used as the secondary antibody.
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC, IHC-P, IP
ROCK1 Antibody
(154C1465) - (active/ ...
NB100-56596
Western Blot: cleaved ROCK1 Antibody (154C1465) [NB100-56596] - Analysis using Azide Free version of NB100-56596. Cleaved ROCK-1 in A) untreated, B) 1 hour and C) 4 hour staurosporin-treated (2 uM) Jurkat cells using this antibody. Goat anti-mouse Ig HRP secondary antibody and PicoTect ECL substrate solution were used
(1 Review)
(5 Publications)
Species: Hu, Mu, Rt, Ca, Pm, Rb
Applications: WB, ICC/IF
Rac1 Antibody
NB100-91266
Western Blot: Rac1 Antibody [NB100-91266] - WB on tissue lysates. Blocking: 1% LFDM for 30 min at RT; primary antibody dilution: 1:1000 incubated overnight at 4C.
Immunocytochemistry/Immunofluorescence: Rac1 Antibody [NB100-91266] - Mouse Brain (cerebral cortex). ICC/IF image submitted by a verified customer review.
Immunohistochemistry: Rac1 Antibody [NB100-91266] - Rat spinal cord using Rabbit antibody to RAC1, RAC2 (100-150) at 1:1000 dilution. Pre-absorption of the antibody with the immunising peptide completely abolishes the immunostaining (not shown).
(1 Review)
(3 Publications)
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
Complement C3
Antibody (11H9)
NB200-540
Flow (Intracellular): Complement C3 Antibody (11H9) [NB200-540] - An intracellular stain was performed on RAW 246.7 cells with Complement C3 (11H9-3-2) antibody NB200-540 (blue) and a matched isotype control NBP2-31382 (orange). Cells were either treated with 3uM Monensin for 3 hours to block the secretion of Complement C3 (B) or grown in normal media (A). Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 2 ug/mL for 30 minutes at room temperature, followed by mouse F(ab)2 IgG (H+L) PE-conjugated secondary antibody (F0102B, R&D Systems).
Immunocytochemistry/Immunofluorescence: Complement C3 Antibody (11H9) [NB200-540] - C3 protein fragments deposited on kidney cells of MPL-lpr mouse. Staining with antibody 11H9. Glomerular staining pattern. Fixation in 4% paraformaldehyde in PBS pH 7.4. Vibratome sections of 4 um. Pretreated with 3% hydrogen peroxide for 20 min to quench endogenous peroxidases. Microwaved in antigen unmasking solution for 2-5 minutes as antigen retrieval.
Immunohistochemistry-Paraffin: Complement C3 Antibody (11H9) [NB200-540] - Complement C3 protein in a FFPE tissue section of mouse liver using 1:100 dilution of Complement C3 antibody (clone 11H9) NB200-540. Weak but distinct membrane-cytoplasmic immunopositivity was observed in hepatocytes and few cells developed punctate membrane staining.
(2 Reviews)
(9 Publications)
Species: Mu
Applications: Flow, IA, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
ERK2 Antibody
(191801) [Unconjugate
MAB1230
Western blot shows lysates of HeLa human cervical epithelial carcinoma cell line, MCF‑7 human breast cancer cell line, U937 human histiocytic lymphoma cell line,PC‑12 rat adrenal pheochromocytoma cell line, and NIH‑3T3 mouse embryonic fibroblast cell line. PVDF membrane was probed with 1 µg/mL of Mouse Anti-Human/Mouse/Rat ERK2 Monoclonal Antibody (Catalog # MAB1230) followed by HRP-conjugated Anti-Mouse IgG Secondary Antibody (Catalog # HAF007). A specific band was detected for ERK2 at approximately 44 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
ERK2 was detected in immersion fixed 3T3‑L1 mouse embryonic fibroblast adipose-like cell line using Mouse Anti-Human/Mouse/Rat ERK2 Monoclonal Antibody (Catalog # MAB1230) at 3 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Mouse IgG Secondary Antibody (red; Catalog # NL007) and counterstained with DAPI (blue). Specific staining was localized to cytoplasm and nuclei. View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
Simple Western lane view shows lysates of HeLa human cervical epithelial carcinoma cell line and MCF‑7 human breast cancer cell line, loaded at 0.5 mg/mL. A specific band was detected for ERK2 at approximately 43 kDa (as indicated) using 10 µg/mL of Mouse Anti-Human/Mouse/Rat ERK2 Monoclonal Antibody (Catalog # MAB1230). This experiment was conducted under reducing conditions and using the 12-230 kDa separation system.
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, ICC, KO
GRK1 Antibody (D11)
NB120-2776
Immunocytochemistry/Immunofluorescence: GRK1 Antibody (D11) [NB120-2776] - Formalin-fixed cells were permeabilized with 0.1% Triton X-100 in TBS for 5-10 minutes at room temperature and blocked with 3% BSA-PBS for 30 minutes at room temperature. Cells were probed with a Rhodopsin Kinase 1a/b Monclonal Antibody (D11) at a dilution of 1:200 and incubated overnight in a humidified chamber. Cells were washed with PBST and incubated with a DyLight-conjugated secondary antibody for 45 minutes at room temperature in the dark. F-actin (red) was stained with a fluorescent phalloidin and nuclei (blue) were stained with DAPI.
Immunocytochemistry/Immunofluorescence: GRK1 Antibody (D11) [NB120-2776] - Immunolocalization of GRK1a/b in bovine retina
Immunocytochemistry/Immunofluorescence: GRK1 Antibody (D11) [NB120-2776] - Analysis of Rhodopsin Kinase 1a/b (green) in Hela cells. Formalin-fixed cells were permeabilized with 0.1% Triton X-100 in TBS for 5-10 minutes at room temperature and blocked with 3% BSA-PBS for 30 minutes at room temperature. Cells were probed with a Rhodopsin Kinase 1a/b Monclonal Antibody (D11) at a dilution of 1:200 and incubated overnight in a humidified chamber. Cells were washed with PBST and incubated with a DyLight-conjugated secondary antibody for 45 minutes at room temperature in the dark. F-actin (red) was stained with a fluorescent phalloidin and nuclei (blue) were stained with DAPI. Images were taken at a 60X magnification.
Species: Hu, Bv
Applications: WB, ICC/IF, IHC, IHC-Fr, IP
LPAR3/LPA3/EDG-7
Antibody
NBP1-84903
Immunocytochemistry/Immunofluorescence: LPAR3/LPA3/EDG-7 Antibody [NBP1-84903] - Staining of human cell line PC-3 shows localization to plasma membrane. Antibody staining is shown in green.
(2 Publications)
Species: Hu, Mu
Applications: WB, ICC/IF, IHC-P
Frizzled-4
Antibody (145901)
MAB194
Frizzled-4 Antibody (145901)
(2 Reviews)
(3 Publications)
Species: Hu, Mu
Applications: WB, Flow, CyTOF-ready, ICC
GPR151 Antibody
NLS418
Immunohistochemistry-Paraffin: GPR151 Antibody [NLS418] - Anti-GPR151 antibody IHC of human Skin, Melanoma. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval.
Immunohistochemistry-Paraffin: GPR151 Antibody [NLS418] - Analysis of anti-GPR151 antibody with brain, thalamus at 2 ug/ ml.
Immunohistochemistry-Paraffin: GPR151 Antibody [NLS418] - Analysis of anti-GPR151 antibody with human brain, glioblastoma.
Species: Hu
Applications: IHC, IHC-P
OXER1/5-oxo-ETE
GPCR Antibody
NLS2272
Immunohistochemistry-Paraffin: OXER1/5-oxo-ETE GPCR Antibody [NLS2272] - Human Pancreas, Carcinoma. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval.
Immunohistochemistry-Paraffin: OXER1/5-oxo-ETE GPCR Antibody [NLS2272] - Analysis of anti-OXER1 antibody with human liver.
Immunohistochemistry-Paraffin: OXER1/5-oxo-ETE GPCR Antibody [NLS2272] - Human Ovary, Carcinoma. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval.
Species: Hu, Pm, Pm
Applications: IHC, IHC-P
MRGX1 Antibody
NLS2756
Immunohistochemistry-Paraffin: MRGX1 Antibody [NLS2756] - Anti-MRGX1 / MRGPRX1 antibody IHC of human Skin, Melanoma. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval.
Immunohistochemistry-Paraffin: MRGX1 Antibody [NLS2756] - Analysis of anti-MRGPRX1 / MRGX1 antibody with human ganglion cells and Schwann cells.
Immunohistochemistry-Paraffin: MRGX1 Antibody [NLS2756] - Anti-MRGX1 / MRGPRX1 antibody IHC of human Ovary, Carcinoma. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval.
Species: Hu, Pm
Applications: IHC, IHC-P, ICC
GPRC6A Antibody
NLS2576
Immunohistochemistry-Paraffin: GPRC6A Antibody [NLS2576] - Brain, Glioblastoma
Immunohistochemistry-Paraffin: GPRC6A Antibody [NLS2576] - Analysis of anti-GPRC6A antibody with human brain, neurons and glia.
Immunohistochemistry-Paraffin: GPRC6A Antibody [NLS2576] - Human Ovary, Carcinoma formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval.
(3 Publications)
Species: Hu, Rt, Pm
Applications: IHC, IHC-P
Rhodopsin Antibody
NBP2-55553
Rhodopsin Antibody
Species: Hu, Mu, Rt
Applications: IHC, IHC-P

Publications for Rhodopsin Antibody (NBP2-55553) (0)

There are no publications for Rhodopsin Antibody (NBP2-55553).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Rhodopsin Antibody (NBP2-55553) (0)

There are no reviews for Rhodopsin Antibody (NBP2-55553). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for Rhodopsin Antibody (NBP2-55553) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Learn about Custom Antibody Labeling

Additional Rhodopsin Products

Bioinformatics Tool for Rhodopsin Antibody (NBP2-55553)

Discover related pathways, diseases and genes to Rhodopsin Antibody (NBP2-55553). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Rhodopsin Antibody (NBP2-55553)

Discover more about diseases related to Rhodopsin Antibody (NBP2-55553).
 

Pathways for Rhodopsin Antibody (NBP2-55553)

View related products by pathway.

PTMs for Rhodopsin Antibody (NBP2-55553)

Learn more about PTMs related to Rhodopsin Antibody (NBP2-55553).
 

Research Areas for Rhodopsin Antibody (NBP2-55553)

Find related products by research area.

Blogs on Rhodopsin.

Check out the latest blog posts on Rhodopsin.
Vision Infographic: Do you see how I see?
Vision involves several parts of the eye processing light which send signals to the brain via the optic nerve to process information. Learn more about the vision process and related ocular proteins in the infographic below. Novus Biological...  Read full blog post.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Rhodopsin Antibody and receive a gift card or discount.


Bioinformatics

Gene Symbol RHO