RhoC Antibody - BSA Free

Immunohistochemistry: RhoC Antibody [NBP2-38651] - Staining of human small intestine shows strong cytoplasmic and membranous positivity in glandular cells.

• Reactivity: Hu
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

RhoC Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit RhoC Antibody - BSA Free (NBP2-38651) is a polyclonal antibody validated for use in IHC. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: KDLRKAGTWRTGSVPLATLSAQPRPRRECGRCLRWPLGLASRSARTSVGGAVPFSEIPKAFPTC
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: RHOC
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  RhoC Protein (NBP2-38651PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for RhoC Antibody - BSA Free

• ARH9ARHCRho cDNA clone 9
• H9
• MGC1448
• MGC61427
• oncogene RHO H9
• ras homolog gene family, member C
• RAS-related homolog 9
• rhoC GTPase
• RhoC
• RHOH9
• rho-related GTP-binding protein RhoC
• small GTP binding protein RhoC

Background

RhoC encodes a member of the Rho family of small GTPases, which cycle between inactive GDP-bound and active GTP-bound states and function as molecular switches in signal transduction cascades. Rho proteins promote reorganization of the actin cytoskeleton and regulate cell shape, attachment, and motility. The protein encoded by this gene is prenylated at its C-terminus, and localizes to the cytoplasm and plasma membrane. It is thought to be important in cell locomotion. Overexpression of this gene is associated with tumor cell proliferation and metastasis. Multiple alternatively spliced variants, encoding the same protein, have been identified.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: RHOC