| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Format | Azide and BSA Free |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 100-190 of human RhoB (NP_004031.1). VPEVKHFCPNVPIILVANKKDLRSDEHVRTELARMKQEPVRTDDGRAMAVRIQAYDYLECSAKTKEGVREVFETATRAALQKRYGSQNGCI |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | RHOB |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
|
| Theoretical MW | 22 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
|
| Publications |
|
| Storage | Store at -20C. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.3), 50% glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Affinity purified |
| Publication using NBP2-94104 | Applications | Species |
|---|---|---|
| Consalvo KM, Kirolos SA, Sestak CE, Gomer RH. Sex-Based Differences in Human Neutrophil Chemorepulsion The Journal of Immunology 2022-07-15 [PMID: 35793910] |
Secondary Antibodies |
Isotype Controls |
Research Areas for RhoB Antibody (NBP2-94104)Find related products by research area.
|
|
Suppressing breast cancer metastasis: The role of hypoxia-induced RhoB expression and activation By Jamshed Arslan, Pharm. D., PhD. The Ras homologous (Rho) GTPase family of signaling molecules has over 20 members, which typically cycle between active (GTP-bound) and inactive (GDP-bound) states. These small GTPa... Read full blog post. |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | RHOB |