RHEBL1 Antibody

Images

 
Immunohistochemistry: RHEBL1 Antibody [NBP2-32581] - Staining of human liver shows strong cytoplasmic positivity in hepatocytes.
Immunohistochemistry: RHEBL1 Antibody [NBP2-32581] - Staining of human liver shows strong cytoplasmic positivity in hepatocytes.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

RHEBL1 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: SSARENQLTQGIFTKVIQEIARVENSYGQERRCHLM
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
RHEBL1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
RHEBL1 Protein (NBP2-32581PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (81%), Rat (81%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for RHEBL1 Antibody

  • FLJ25797
  • GTPase RhebL1
  • MGC34869
  • Ras homolog enriched in brain like 1 c
  • Ras homolog enriched in brain like 1
  • Ras homolog enriched in brain like-1 c
  • Ras homolog enriched in brain-like protein 1
  • rheb2
  • RHEBL1c
  • Rheb-like protein 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-240
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IP, PLA
MAB3426
Species: Hu, Mu, Rt
Applications: WB, IHC
NB100-1595
Species: Hu, Mu
Applications: WB, IHC-P, IP
NBP1-87799
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-46234
Species: Hu
Applications: WB, IHC
NB200-157
Species: Hu
Applications: WB, IHC, IHC-P
MAB40401
Species: Hu, Mu
Applications: WB, IHC, ICC
AF8962
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow
NBP2-13426
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF3580
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC
NBP1-86376
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-97841
Species: Hu
Applications: IP (-), WB
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NB100-331
Species: Hu, Mu, Rt
Applications: IP (-), WB
NBP2-24449
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow
NBP2-29617
Species: Hu
Applications: WB, IHC, IHC-Fr, IHC-P
NBP1-91795
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-58906
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P

Publications for RHEBL1 Antibody (NBP2-32581) (0)

There are no publications for RHEBL1 Antibody (NBP2-32581).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RHEBL1 Antibody (NBP2-32581) (0)

There are no reviews for RHEBL1 Antibody (NBP2-32581). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for RHEBL1 Antibody (NBP2-32581) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional RHEBL1 Products

Bioinformatics Tool for RHEBL1 Antibody (NBP2-32581)

Discover related pathways, diseases and genes to RHEBL1 Antibody (NBP2-32581). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RHEBL1 Antibody (NBP2-32581)

Discover more about diseases related to RHEBL1 Antibody (NBP2-32581).
 

Pathways for RHEBL1 Antibody (NBP2-32581)

View related products by pathway.

PTMs for RHEBL1 Antibody (NBP2-32581)

Learn more about PTMs related to RHEBL1 Antibody (NBP2-32581).
 

Research Areas for RHEBL1 Antibody (NBP2-32581)

Find related products by research area.

Blogs on RHEBL1

There are no specific blogs for RHEBL1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our RHEBL1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol RHEBL1