RHEBL1 Antibody - BSA Free

Immunohistochemistry: RHEBL1 Antibody [NBP2-32581] - Staining of human liver shows strong cytoplasmic positivity in hepatocytes.

• Reactivity: Hu
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

RHEBL1 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit RHEBL1 Antibody - BSA Free (NBP2-32581) is a polyclonal antibody validated for use in IHC. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: SSARENQLTQGIFTKVIQEIARVENSYGQERRCHLM
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: RHEBL1
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  RHEBL1 Protein (NBP2-32581PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (81%), Rat (81%)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for RHEBL1 Antibody - BSA Free

• FLJ25797
• GTPase RhebL1
• MGC34869
• Ras homolog enriched in brain like 1 c
• Ras homolog enriched in brain like 1
• Ras homolog enriched in brain like-1 c
• Ras homolog enriched in brain-like protein 1
• rheb2
• RHEBL1c
• Rheb-like protein 1

Background

RHEBL1 (Ras Homolog Enriched In Brain Like 1) is involved in mediating signal transduction and regulating NF-kappa B-mediated gene transcription. RHEBL1 is known to have interactions with MTOR, ACVR1, SMAD2, TXNL4A and EIF4EBP1. RHEBL1 has been studied in relation to tuberous sclerosis, renal clear cell carcinoma and angiomyolipoma.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: RHEBL1