RGL3 Antibody

Images

 
Western Blot: RGL3 Antibody [NBP1-68976] - Titration: 0.2-1 ug/ml, Positive Control: HepG2 cell lysate.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

RGL3 Antibody Summary

Immunogen
Synthetic peptides corresponding to RGL3 (ral guanine nucleotide dissociation stimulator-like 3) The peptide sequence was selected from the middle region of RGL3. Peptide sequence RNFSSLRAILSALQSNPIYRLKRSWGAVSREPLSTFRKLSQIFSDENNHL.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
RGL3
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against RGL3 and was validated on Western blot.
Theoretical MW
78 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for RGL3 Antibody

  • FLJ00153
  • FLJ32585
  • FLJ44275
  • MGC126805
  • MGC138163
  • ral guanine nucleotide dissociation stimulator-like 3
  • RalGDS-like 3
  • RalGEF-like protein 3, mouse homolog

Background

RGL3 is a guanine nucleotide exchange factor (GEF) for Ral-A. RGL3 is a potential effector of GTPase HRas and Ras-related protein M-Ras. RGL3 negatively regulates Elk-1-dependent gene induction downstream of HRas and MEKK1.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-30584
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00005863-M02
Species: Hu
Applications: WB, ELISA, ICC/IF
AF3204
Species: Hu, Mu, Rt
Applications: WB
NBP1-76544
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ELISA, ICC/IF, IHC, IHC-P
H00023179-M01
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
NBP1-88866
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-15454
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-45745
Species: Hu
Applications: WB, IHC, IF
NBP1-81223
Species: Hu
Applications: IHC, IHC-P
NBP1-33086
Species: Hu
Applications: WB, ICC/IF
MAB4540
Species: Hu, Mu, Rt
Applications: WB, IHC
NB110-74682
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
MAB4697
Species: Hu
Applications: WB
NB100-1704
Species: Hu, Mu
Applications: WB, IHC-P, IP
NBP2-45570
Species: Hu
Applications: WB, Flow, IHC
NB100-230
Species: Hu
Applications: WB, IP, PLA
NB100-94887
Species: Hu, Rt
Applications: WB, IHC, IHC-P, PEP-ELISA
NBP1-68976
Species: Hu
Applications: WB

Publications for RGL3 Antibody (NBP1-68976) (0)

There are no publications for RGL3 Antibody (NBP1-68976).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RGL3 Antibody (NBP1-68976) (0)

There are no reviews for RGL3 Antibody (NBP1-68976). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for RGL3 Antibody (NBP1-68976) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional RGL3 Products

Bioinformatics Tool for RGL3 Antibody (NBP1-68976)

Discover related pathways, diseases and genes to RGL3 Antibody (NBP1-68976). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RGL3 Antibody (NBP1-68976)

Discover more about diseases related to RGL3 Antibody (NBP1-68976).
 

Pathways for RGL3 Antibody (NBP1-68976)

View related products by pathway.

PTMs for RGL3 Antibody (NBP1-68976)

Learn more about PTMs related to RGL3 Antibody (NBP1-68976).

Blogs on RGL3

There are no specific blogs for RGL3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our RGL3 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol RGL3
Uniprot