RFXAP Antibody (1B5)

Images

 
Western Blot: RFXAP Antibody (1B5) [H00005994-M01] - Analysis of RFXAP expression in transfected 293T cell line by RFXAP monoclonal antibody (M01), clone 1B5.Lane 1: RFXAP transfected lysate (Predicted MW: 28.3 ...read more
Sandwich ELISA: RFXAP Antibody (1B5) [H00005994-M01] - Detection limit for recombinant GST tagged RFXAP is approximately 3ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA
Clone
1B5
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

RFXAP Antibody (1B5) Summary

Immunogen
RFXAP (NP_000529 179 a.a. - 244 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. SDQALNCGGTASTGSAGNVKLEESADNILSIVKQRTGSFGDRPARPTLLEQVLNQKRLSLLRSPEV
Specificity
RFXAP - regulatory factor X-associated protein (1B5)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
RFXAP
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
Application Notes
It has been used for ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for RFXAP Antibody (1B5)

  • regulatory factor X-associated protein
  • RFX DNA-binding complex 36 kDa subunit
  • RFX-associated protein

Background

Major histocompatibility (MHC) class II molecules are transmembrane proteins that have a central role in development and control of the immune system. The protein encoded by this gene, along with regulatory factor X-associated ankyrin-containing protein and regulatory factor-5, forms a complex that binds to the X box motif of certain MHC class II gene promoters and activates their transcription. Once bound to the promoter, this complex associates with the non-DNA-binding factor MHC class II transactivator, which controls the cell type specificity and inducibility of MHC class II gene expression. Mutations in this gene have been linked to bare lymphocyte syndrome type II, complementation group D. Transcript variants utilizing different polyA signals have been found for this gene. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-01756
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB100-195
Species: Hu
Applications: WB, IHC, IHC-P, IP
NBP1-52654
Species: Hu, Mu
Applications: WB, IHC-P, IP
NBP2-59072
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC-Fr, IHC-P, MeDIP
NB120-6405
Species: Rt
Applications: B/N, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP1-19371
Species: Hu, Mu, Rt, Ca, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NB100-410
Species: Hu, Mu
Applications: WB, IP
NBP2-29931
Species: Hu
Applications: WB, Flow, IHC-P
NBP1-71805
Species: Hu
Applications: WB, IP
H00010153-B01P
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
NBP2-19534
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
H00004802-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P, RNAi
H00000466-D01P
Species: Hu, Mu, Rt
Applications: WB
NBP2-29950
Species: Hu, Mu
Applications: WB, Flow, IHC-P
NB100-2594
Species: Hu, Mu
Applications: WB, ChIP, IHC-P, IP, PLA
NBP2-53380
Species: Hu
Applications: ICC/IF, IHC-P, PAGE
H00057763-M01
Species: Hu
Applications: WB, ELISA, ICC/IF

Publications for RFXAP Antibody (H00005994-M01) (0)

There are no publications for RFXAP Antibody (H00005994-M01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RFXAP Antibody (H00005994-M01) (0)

There are no reviews for RFXAP Antibody (H00005994-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for RFXAP Antibody (H00005994-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional RFXAP Products

Bioinformatics Tool for RFXAP Antibody (H00005994-M01)

Discover related pathways, diseases and genes to RFXAP Antibody (H00005994-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RFXAP Antibody (H00005994-M01)

Discover more about diseases related to RFXAP Antibody (H00005994-M01).
 

Pathways for RFXAP Antibody (H00005994-M01)

View related products by pathway.

PTMs for RFXAP Antibody (H00005994-M01)

Learn more about PTMs related to RFXAP Antibody (H00005994-M01).
 

Research Areas for RFXAP Antibody (H00005994-M01)

Find related products by research area.

Blogs on RFXAP

There are no specific blogs for RFXAP, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our RFXAP Antibody (1B5) and receive a gift card or discount.

Bioinformatics

Gene Symbol RFXAP
Entrez
Uniprot