RFXAP Antibody (1B5)


Western Blot: RFXAP Antibody (1B5) [H00005994-M01] - Analysis of RFXAP expression in transfected 293T cell line by RFXAP monoclonal antibody (M01), clone 1B5.Lane 1: RFXAP transfected lysate (Predicted MW: 28.3 ...read more
Sandwich ELISA: RFXAP Antibody (1B5) [H00005994-M01] - Detection limit for recombinant GST tagged RFXAP is approximately 3ng/ml as a capture antibody.

Product Details

Reactivity HuSpecies Glossary
Applications WB, ELISA

Order Details

RFXAP Antibody (1B5) Summary

RFXAP (NP_000529 179 a.a. - 244 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. SDQALNCGGTASTGSAGNVKLEESADNILSIVKQRTGSFGDRPARPTLLEQVLNQKRLSLLRSPEV
RFXAP - regulatory factor X-associated protein (1B5)
IgG2a Kappa
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot
Application Notes
It has been used for ELISA.

Packaging, Storage & Formulations

Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
PBS (pH 7.4)
No Preservative
IgG purified


Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for RFXAP Antibody (1B5)

  • regulatory factor X-associated protein
  • RFX DNA-binding complex 36 kDa subunit
  • RFX-associated protein


Major histocompatibility (MHC) class II molecules are transmembrane proteins that have a central role in development and control of the immune system. The protein encoded by this gene, along with regulatory factor X-associated ankyrin-containing protein and regulatory factor-5, forms a complex that binds to the X box motif of certain MHC class II gene promoters and activates their transcription. Once bound to the promoter, this complex associates with the non-DNA-binding factor MHC class II transactivator, which controls the cell type specificity and inducibility of MHC class II gene expression. Mutations in this gene have been linked to bare lymphocyte syndrome type II, complementation group D. Transcript variants utilizing different polyA signals have been found for this gene. [provided by RefSeq]


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P, IP
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC-Fr, IHC-P, MeDIP
Species: Rt
Applications: B/N, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
Species: Hu, Mu, Rt, Ca, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, IP
Species: Hu
Applications: WB, Flow, IHC-P
Species: Hu
Applications: WB, IP
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC-P, IP, ChIP
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P, RNAi
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, KD
Species: Hu, Mu
Applications: WB, Flow, IHC-P
Species: Hu, Mu
Applications: WB, ChIP, IHC, IHC-P, IP, PLA
Species: Hu
Applications: ICC/IF, IHC-P, PAGE
Species: Hu
Applications: WB, ELISA, ICC/IF

Publications for RFXAP Antibody (H00005994-M01) (0)

There are no publications for RFXAP Antibody (H00005994-M01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RFXAP Antibody (H00005994-M01) (0)

There are no reviews for RFXAP Antibody (H00005994-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for RFXAP Antibody (H00005994-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional RFXAP Products

Bioinformatics Tool for RFXAP Antibody (H00005994-M01)

Discover related pathways, diseases and genes to RFXAP Antibody (H00005994-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RFXAP Antibody (H00005994-M01)

Discover more about diseases related to RFXAP Antibody (H00005994-M01).

Pathways for RFXAP Antibody (H00005994-M01)

View related products by pathway.

PTMs for RFXAP Antibody (H00005994-M01)

Learn more about PTMs related to RFXAP Antibody (H00005994-M01).

Research Areas for RFXAP Antibody (H00005994-M01)

Find related products by research area.

Blogs on RFXAP

There are no specific blogs for RFXAP, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our RFXAP Antibody (1B5) and receive a gift card or discount.


Gene Symbol RFXAP