RFWD3 Antibody

Immunocytochemistry/Immunofluorescence: RFWD3 Antibody [NBP2-57566] - Staining of human cell line MCF7 shows localization to nucleoplasm.

Product Discontinued

RFWD3 Antibody Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: RLQRRVQDLQKLTSHQSQNLQQPRGSQAWVLSCSPSSQGQHKHKYHFQKTFTVSQAGNCRIMAYCDALSCLVISQPSPQASFLPGFGVKML
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: RFWD3
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
• Application Notes: Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for RFWD3 Antibody

• EC 6.3.2.-
• FLJ10520
• ring finger and WD repeat domain 3
• RING finger and WD repeat domain-containing protein 3
• RING finger protein 201
• RNF201E3 ubiquitin-protein ligase RFWD3

Background

RFWD3 (ring finger and WD repeat domain 3) has been identified as a protein that is phosphorylated in response to DNA damage. The exact function of RFWD3 (ring finger and WD repeat domain 3) has not been characterized. Structurally, RFWD3 possesses a RING-type zinc finger and 3 WD repeats.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: RFWD3