Recombinant Human RFC2 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human RFC2 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 245-353 of Human RFC2 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:FINSENVFKVCDEPHPLLVKEMIQHCVNANIDEAYKILAHLWHLGYSPEDIIGNIFRVCKTFQMAEYLKLEFIKEIGYTHMKIAEGVNSLLQMAGLLARLCQKTMAPVA

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
RFC2

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human RFC2 Protein

  • A1 40 kDa subunit
  • A1
  • Activator 1 40 kDa subunit
  • Activator 1 subunit 2
  • MGC3665
  • replication factor C (activator 1) 2, 40kDa
  • replication factor C 2
  • Replication factor C 40 kDa subunit
  • replication factor C subunit 2
  • RF-C 40 kDa subunit
  • RFC40replication factor C (activator 1) 2 (40kD)

Background

RFC2 - replication factor C (activator 1) 2, 40kDa

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-59069
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-90306
Species: Hu
Applications: WB, IHC, IHC-P
NBL1-11228
Species: Hu
NBP1-89333
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
NBP1-88927
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-36776
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-43435
Species: Hu, Mu
Applications: WB, Flow
H00728695-B01P
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
NBP1-83013
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-88527
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-88526
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-13075
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP, IHC-FrFl
NBP1-89330
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-59744
Species: Hu, Mu
Applications: WB, IHC, IHC-Fr
NBP1-62539
Species: Hu
Applications: WB
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
AF1936
Species: Hu
Applications: WB, IP
NBP2-52979
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
H00005982-Q01
Species: Hu
Applications: WB, ELISA, PA

Publications for RFC2 Partial Recombinant Protein (H00005982-Q01) (0)

There are no publications for RFC2 Partial Recombinant Protein (H00005982-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RFC2 Partial Recombinant Protein (H00005982-Q01) (0)

There are no reviews for RFC2 Partial Recombinant Protein (H00005982-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for RFC2 Partial Recombinant Protein (H00005982-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional RFC2 Products

Bioinformatics Tool for RFC2 Partial Recombinant Protein (H00005982-Q01)

Discover related pathways, diseases and genes to RFC2 Partial Recombinant Protein (H00005982-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RFC2 Partial Recombinant Protein (H00005982-Q01)

Discover more about diseases related to RFC2 Partial Recombinant Protein (H00005982-Q01).
 

Pathways for RFC2 Partial Recombinant Protein (H00005982-Q01)

View related products by pathway.

PTMs for RFC2 Partial Recombinant Protein (H00005982-Q01)

Learn more about PTMs related to RFC2 Partial Recombinant Protein (H00005982-Q01).
 

Research Areas for RFC2 Partial Recombinant Protein (H00005982-Q01)

Find related products by research area.

Blogs on RFC2

There are no specific blogs for RFC2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human RFC2 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol RFC2