Rev-erb A alpha/NR1D1 Antibody (9I2H1)

Western Blot: Rev-erb A alpha/NR1D1 Antibody (9I2H1) [NBP3-15898] - Western blot analysis of extracts of various cell lines, using Rev-erb A alpha/NR1D1 antibody (NBP3-15898) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 30s.

Western Blot: Rev-erb A alpha/NR1D1 Antibody (9I2H1) [NBP3-15898] - Western blot analysis of extracts of Mouse liver, using Rev-erb A alpha/NR1D1 antibody (NBP3-15898) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 10s.

Western Blot: Rev-erb A alpha/NR1D1 Antibody (9I2H1) [NBP3-15898] - Western blot analysis of extracts of HepG2, using Rev-erb A alpha/NR1D1 antibody (NBP3-15898) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 180s.

Confocal imaging of Hep G2 cells using Rev-Erb alpha /NR1D1 Rabbit mAb (A20452, dilution 1:200) followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) (dilution 1:500) (Red). The cells were counterstained with alpha -Tubulin Mouse mAb ( dilution 1:400) followed by incubation with ABflo® 488-conjugated Goat Anti-Mouse IgG (H+L) Ab (dilution 1:500) (Green). DAPI was used for nuclear staining (Blue). Objective: 100x.

Paraffin-embedded Mouse brain tissue using Rev-Erb alpha /NR1D1 Rabbit mAb , (dilution 1:200) followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) (dilution 1:500) (Red). DAPI was used for nuclear staining (Blue). High pressure antigen retrieval performed with 0.01M Citrate Buffer (pH 6.0) prior to IF staining. Objective: 40x.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ELISA, ICC/IF, IHC
• Clone: 9I2H1
• Clonality: Monoclonal
• Host: Rabbit
• Conjugate: Unconjugated

Rev-erb A alpha/NR1D1 Antibody (9I2H1) Summary

• Description: Novus Biologicals Rabbit Rev-erb A alpha/NR1D1 Antibody (9I2H1) (NBP3-15898) is a recombinant monoclonal antibody validated for use in IHC, WB, ELISA and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Additional Information: Recombinant Monoclonal Antibody
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 280-360 of human Rev-erb A alpha/NR1D1 (NP_068370.1). SPEPTVEDVISQVARAHREIFTYAHDKLGSSPGNFNANHASGSPPATTPHRWENQGCPPAPNDNNTLAAQRHNEALNGLRQ
• Source: HEK293
• Isotype: IgG
• Clonality: Monoclonal
• Host: Rabbit
• Gene: NR1D1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • ELISA Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements.
  • Immunocytochemistry/ Immunofluorescence 1:100 - 1:400
  • Immunohistochemistry 1:500
  • Immunohistochemistry-Paraffin 1:500
  • Western Blot 1:1000 - 1:2000
• Theoretical MW: 67 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol, 0.05% BSA
• Preservative: 0.05% Proclin 300
• Purity: Affinity purified

Alternate Names for Rev-erb A alpha/NR1D1 Antibody (9I2H1)

• Ear-1
• EAR1nuclear receptor subfamily 1 group D member 1
• HREV
• NR1D1
• nuclear receptor subfamily 1, group D, member 1
• Reverb A alpha
• Rev-erb A alpha
• Rev-ErbAalpha
• Rev-erbA-alpha
• THRA1
• THRAL
• THRALrev-erbA-alpha
• V-erbA-related protein 1

Background

NR1D1 functions as a constitutive transcriptional repressor. Possible receptor for triiodothyronine

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: NR1D1