Retinoblastoma binding protein 1 Antibody - BSA Free

Western Blot: Retinoblastoma binding protein 1 Antibody [NBP2-86774] - WB Suggested Anti-ARID4A Antibody Titration: 1.25ug/ml. Positive Control: HepG2 cell lysate

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 1 mg/ml

Retinoblastoma binding protein 1 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit Retinoblastoma binding protein 1 Antibody - BSA Free (NBP2-86774) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of human Retinoblastoma binding protein 1. Peptide sequence: NSSKCTPVKHLNVSKPQKLARSPARISPHIKDGEKDKHREKHPNSSPRTY The peptide sequence for this immunogen was taken from within the described region.
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ARID4A
• Purity: Protein A purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 1 mg/ml
• Purity: Protein A purified

Alternate Names for Retinoblastoma binding protein 1 Antibody - BSA Free

• AT rich interactive domain 4A (RBP1-like)
• RBBP-1
• RBP-1
• RBP1ARID domain-containing protein 4A
• retinoblastoma binding protein 1
• Retinoblastoma-binding protein 1RBBP1AT-rich interactive domain-containing protein 4A

Background

ARID4A (AT-rich interactive domain-containing protein 4A) is also known as RbBP1 (retinoblastoma binding protein 1) and is a retinoblastoma binding protein and member of the AT-rich interaction domain (ARID) family of proteins. In addition to the ARID DNA binding domain, ARID4A also contains a chromo domain and a TUDOR domain, indicating a function in chromatin organization and protein-protein interactions with methylated protein substrates. ARID4A is implicated to be involved in chromatin remodeling and epigenetic modifications and to play a role in the pathogenesis of cancer.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: ARID4A