Recombinant Human RERE GST (N-Term) Protein

Images

 
SDS-Page: Recombinant Human RERE Protein [H00000473-Q01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, AP

Order Details

Recombinant Human RERE GST (N-Term) Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 85-193 of Human RERE

Source: Wheat Germ (in vitro)

Amino Acid Sequence: RYERTDTGEITSYITEDDVVYRPGDCVYIVCRRPNTPYFICSIQDFKLVHNSQACCRSPTPALCDPPACSLPVASQPPQHLSEAGRGPVGSKRDHLLMNVKWYYRQSEV

Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Partial Recombinant Protein
Gene
RERE
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • Western Blot
Theoretical MW
37.73 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human RERE GST (N-Term) Protein

  • ARGARPKIAA0458arginine-glutamic acid dipeptide repeats protein
  • arginine-glutamic acid dipeptide (RE) repeats
  • ATN1L
  • atrophin 2
  • atrophin-1 like protein
  • atrophin-1 related protein
  • Atrophin-1-like protein
  • Atrophin-1-related protein
  • DNB1
  • FLJ38775

Background

This gene encodes a member of the atrophin family of arginine-glutamic acid (RE) dipeptide repeat-containing proteins. The encoded protein co-localizes with a transcription factor in the nucleus, and its overexpression triggers apoptosis. A similar protein in mouse associates with histone deacetylase and is thought to function as a transcriptional co-repressor during embryonic development. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00010097-M01
Species: Hu
Applications: ELISA, IHC, IHC-P, S-ELISA, WB
H00002691-T01
Species: Hu
Applications: WB
AF1067
Species: Hu, Mu, Rt
Applications: ELISA, IHC, Neut, WB
NBP1-90927
Species: Hu
Applications: IHC, IHC-P, WB
NBP2-75395
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP1-30955
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
AF1444
Species: Mu
Applications: IHC, WB
NB300-996
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P, PEP-ELISA, WB
AF1067
Species: Hu, Mu, Rt
Applications: ELISA, IHC, Neut, WB
MAB1417
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow
NBP2-37447
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, IF, IHC, IHC-P, WB
NBP1-82512
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KD, Simple Western, WB
AF5414
Species: Hu
Applications: Simple Western, WB
NB300-605
Species: Hu, Mu, Po, Rt
Applications: Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, In vitro, WB
NBP2-82648
Species: Hu
Applications: WB
NBP2-67632
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, IP, WB
NB100-1519
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC-FrFl, PEP-ELISA, WB
NB100-56603
Species: Ca, Hu, Mu, Pm, Rt
Applications: IHC, IHC-P, WB
PP-H7147-00
Species: Hu
Applications: IHC, IP, WB

Publications for RERE Partial Recombinant Protein (H00000473-Q01) (0)

There are no publications for RERE Partial Recombinant Protein (H00000473-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RERE Partial Recombinant Protein (H00000473-Q01) (0)

There are no reviews for RERE Partial Recombinant Protein (H00000473-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for RERE Partial Recombinant Protein (H00000473-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional RERE Products

Array H00000473-Q01

Bioinformatics Tool for RERE Partial Recombinant Protein (H00000473-Q01)

Discover related pathways, diseases and genes to RERE Partial Recombinant Protein (H00000473-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RERE Partial Recombinant Protein (H00000473-Q01)

Discover more about diseases related to RERE Partial Recombinant Protein (H00000473-Q01).
 

Pathways for RERE Partial Recombinant Protein (H00000473-Q01)

View related products by pathway.

PTMs for RERE Partial Recombinant Protein (H00000473-Q01)

Learn more about PTMs related to RERE Partial Recombinant Protein (H00000473-Q01).
 

Research Areas for RERE Partial Recombinant Protein (H00000473-Q01)

Find related products by research area.

Blogs on RERE

There are no specific blogs for RERE, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human RERE GST (N-Term) Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol RERE