Recombinant Human RERE Protein

Images

 
SDS-Page: Recombinant Human RERE Protein [H00000473-Q01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human RERE Protein Summary

Description
Recombinant protein with GST-tag at N-terminal corresponding to the amino acids 85 - 193 of Human RERE partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:RYERTDTGEITSYITEDDVVYRPGDCVYIVCRRPNTPYFICSIQDFKLVHNSQACCRSPTPALCDPPACSLPVASQPPQHLSEAGRGPVGSKRDHLLMNVKWYYRQSEV

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
RERE

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human RERE Protein

  • ARGARPKIAA0458arginine-glutamic acid dipeptide repeats protein
  • arginine-glutamic acid dipeptide (RE) repeats
  • ATN1L
  • atrophin 2
  • atrophin-1 like protein
  • atrophin-1 related protein
  • Atrophin-1-like protein
  • Atrophin-1-related protein
  • DNB1
  • FLJ38775

Background

This gene encodes a member of the atrophin family of arginine-glutamic acid (RE) dipeptide repeat-containing proteins. The encoded protein co-localizes with a transcription factor in the nucleus, and its overexpression triggers apoptosis. A similar protein in mouse associates with histone deacetylase and is thought to function as a transcriptional co-repressor during embryonic development. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00010097-M01
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
NBP2-29915
Species: Hu
Applications: WB, ICC/IF, IHC-P
AF1067
Species: Hu, Mu, Rt
Applications: WB, IHC, Neut
H00010096-M02
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-30955
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
AF1444
Species: Mu
Applications: WB, IHC
NB100-2307
Species: Hu
Applications: WB
AF1067
Species: Hu, Mu, Rt
Applications: WB, IHC, Neut
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
MAB2358
Species: Hu, Mu
Applications: IHC, ICC
AF3854
Species: Hu, Mu, Rt
Applications: WB, IHC, ICC
AF5414
Species: Hu
Applications: WB, Simple Western
NB300-605
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-88999
Species: Hu
Applications: IHC, IHC-P
NBP2-15971
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-22449
Species: Hu, Mu, Rt, Fe, GP, Rb
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, IP, GS
NB100-56603
Species: Hu, Pm
Applications: WB, IHC, IHC-P
PP-H7147-00
Species: Hu
Applications: WB, IHC, IP

Publications for RERE Partial Recombinant Protein (H00000473-Q01) (0)

There are no publications for RERE Partial Recombinant Protein (H00000473-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RERE Partial Recombinant Protein (H00000473-Q01) (0)

There are no reviews for RERE Partial Recombinant Protein (H00000473-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for RERE Partial Recombinant Protein (H00000473-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional RERE Products

Bioinformatics Tool for RERE Partial Recombinant Protein (H00000473-Q01)

Discover related pathways, diseases and genes to RERE Partial Recombinant Protein (H00000473-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RERE Partial Recombinant Protein (H00000473-Q01)

Discover more about diseases related to RERE Partial Recombinant Protein (H00000473-Q01).
 

Pathways for RERE Partial Recombinant Protein (H00000473-Q01)

View related products by pathway.

PTMs for RERE Partial Recombinant Protein (H00000473-Q01)

Learn more about PTMs related to RERE Partial Recombinant Protein (H00000473-Q01).

Blogs on RERE

There are no specific blogs for RERE, but you can read our latest blog posts.

Customers Who Bought This Also Bought

RERE Antibody
NBP1-88838
iNOS Antibody
NB300-605

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human RERE Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol RERE