RERE Antibody

Images

 
Western Blot: RERE Antibody [NBP1-88838] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).
Immunocytochemistry/ Immunofluorescence: RERE Antibody [NBP1-88838] - Staining of human cell line A-431 shows positivity in nucleus but not nucleoli and mitochondria.
Immunohistochemistry-Paraffin: RERE Antibody [NBP1-88838] - Staining of human testis shows strong cytoplasmic positivity in Leydig cells.
Western Blot: RERE Antibody [NBP1-88838] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-472

Product Details

Summary
Reactivity Hu, Mu, Rt, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

RERE Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:MCDGGSTEDGCVAASRDDTTLNALNTLHESGYDAGKALQRLVKKPVPKLIEKCWTEDEVKRFVKGLRQYGKNFFRIRKELLPNKETGELITFYYYWKKTPEAASSRAHRRHRRQAVFRRIKTRTASTPVNTPSR
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (99%), Rat (99%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
RERE
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
RERE Protein (NBP1-88838PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for RERE Antibody

  • ARGARPKIAA0458arginine-glutamic acid dipeptide repeats protein
  • arginine-glutamic acid dipeptide (RE) repeats
  • ATN1L
  • atrophin 2
  • atrophin-1 like protein
  • atrophin-1 related protein
  • Atrophin-1-like protein
  • Atrophin-1-related protein
  • DNB1
  • FLJ38775

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00010097-M01
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
NBP2-29915
Species: Hu
Applications: WB, ICC/IF, IHC-P
AF1067
Species: Hu, Mu, Rt
Applications: WB, IHC, Neut
H00010096-M02
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-30955
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
AF1444
Species: Mu
Applications: WB, IHC
NB100-2307
Species: Hu
Applications: WB
AF1067
Species: Hu, Mu, Rt
Applications: WB, IHC, Neut
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
MAB2358
Species: Hu, Mu
Applications: IHC, ICC
AF3854
Species: Hu, Mu, Rt
Applications: WB, IHC, ICC
AF5414
Species: Hu
Applications: WB, Simple Western
NB300-605
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-88999
Species: Hu
Applications: IHC, IHC-P
NBP2-15971
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-22449
Species: Hu, Mu, Rt, Fe, GP, Rb
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, IP, GS
NB100-56603
Species: Hu, Pm
Applications: WB, IHC, IHC-P
PP-H7147-00
Species: Hu
Applications: WB, IHC, IP

Publications for RERE Antibody (NBP1-88838) (0)

There are no publications for RERE Antibody (NBP1-88838).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RERE Antibody (NBP1-88838) (0)

There are no reviews for RERE Antibody (NBP1-88838). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for RERE Antibody (NBP1-88838) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional RERE Products

Bioinformatics Tool for RERE Antibody (NBP1-88838)

Discover related pathways, diseases and genes to RERE Antibody (NBP1-88838). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RERE Antibody (NBP1-88838)

Discover more about diseases related to RERE Antibody (NBP1-88838).
 

Pathways for RERE Antibody (NBP1-88838)

View related products by pathway.

PTMs for RERE Antibody (NBP1-88838)

Learn more about PTMs related to RERE Antibody (NBP1-88838).

Blogs on RERE

There are no specific blogs for RERE, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our RERE Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol RERE