Recombinant Human Renin R GST (N-Term) Protein

Images

 
SDS-Page: Recombinant Human Renin R Protein [H00010159-P01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, MA, PAGE, AP

Order Details

Recombinant Human Renin R GST (N-Term) Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-350 of Human ATP6AP2

Source: Wheat Germ (in vitro)

Amino Acid Sequence: MAVFVVLLALVAGVLGNEFSILKSPGSVVFRNGNWPIPGERIPDVAALSMGFSVKEDLSWPGLAVGNLFHRPRATVMVMVKGVNKLALPPGSVISYPLENAVPFSLDSVANSIHSLFSEETPVVLQLAPSEERVYMVGKANSVFEDLSVTLRQLRNRLFQENSVLSSLPLNSLSRNNEVDLLFLSELQVLHDISSLLSRHKHLAKDHSPDLYSLELAGLDEIGKRYGEDSEQFRDASKILVDALQKFADDMYSLYGGNAVVELVTVKSFDTSLIRKTRTILEAKQAKNPASPYNLAYKYNFEYSVVFNMVLWIMIALALAVIITSYNIWNMDPGYDSIIYRMTNQKIRMD

Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Recombinant Protein
Gene
ATP6AP2
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • SDS-Page
  • Western Blot
Theoretical MW
65.4 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Renin R GST (N-Term) Protein

  • APT6M8-9
  • ATP6AP2
  • ATP6IP2
  • ATP6M8-9
  • ATP6M8-9MRXE
  • ATPase H(+)-transporting lysosomal accessory protein 2
  • ATPase H(+)-transporting lysosomal-interacting protein 2
  • ATPase, H+ transporting, lysosomal accessory protein 2
  • ATPase, H+ transporting, lysosomal interacting protein 2
  • CAPER
  • ELDF10
  • Embryonic liver differentiation factor 10
  • ER-localized type I transmembrane adaptor
  • H+ transporting, lysosomal (vacuolar proton pump) membrane sectorassociated protein M8-9
  • HT028
  • M8-9
  • MGC99577
  • MRXE
  • MSTP009
  • N14F
  • Renin R
  • renin receptor
  • ReninR
  • vacuolar proton ATP synthase membrane sector associated protein M8-9
  • V-ATPase M8.9 subunit
  • XMRE

Background

This gene encodes a protein that is associated with adenosine triphosphatases (ATPases). Proton-translocating ATPases have fundamental roles in energy conservation, secondary active transport, acidification of intracellular compartments, and cellular pH homeostasis. There are three classes of ATPases- F, P, and V. The vacuolar (V-type) ATPases have a transmembrane proton-conducting sector and an extramembrane catalytic sector. The encoded protein has been found associated with the transmembrane sector of the V-type ATPases. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-30027
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
AF4090
Species: Hu
Applications: IHC, IP, Neut, WB
AF1513
Species: Mu
Applications: CyTOF-ready, Flow, IHC, IP, Simple Western, WB
DAN00
Species: Hu
Applications: ELISA
NBP2-22203
Species: Hu, Pm, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC,  IHC-P, WB
AF1230
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
PP-H4417-00
Species: Hu
Applications: DirELISA, IP, WB
AF933
Species: Ha, Hu, Mu, Rt
Applications: Block, Flow, IHC, IP, Simple Western, WB
AF467
Species: Hu, Mu
Applications: CyTOF-ready, Flow, ICC, IHC, Simple Western, WB
NBP1-78444
Species: Hu, Mu, Pm, Rb, Rt
Applications: ICC/IF, IHC,  IHC-P, Simple Western, WB
NBP1-77078
Species: Hu, Mu, Rb, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
NBP1-19773
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr,  IHC-P, WB
AF2944
Species: Hu
Applications: Simple Western, WB
NBP1-91258
Species: Bv, Ca, Eq, Fe, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, Simple Western, WB

Publications for Renin R Recombinant Protein (H00010159-P01) (0)

There are no publications for Renin R Recombinant Protein (H00010159-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Renin R Recombinant Protein (H00010159-P01) (0)

There are no reviews for Renin R Recombinant Protein (H00010159-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Renin R Recombinant Protein (H00010159-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Renin R Products

Research Areas for Renin R Recombinant Protein (H00010159-P01)

Find related products by research area.

Blogs on Renin R

There are no specific blogs for Renin R, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human Renin R GST (N-Term) Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol ATP6AP2