Renin R Recombinant Protein Antigen

Images

 
There are currently no images for Renin R Protein (NBP1-90820PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Renin R Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human ATP6AP2.

Source: E. coli

Amino Acid Sequence: NSLSRNNEVDLLFLSELQVLHDISSLLSRHKHLAKDHSPDLYSLELAGLDEIGKRYGEDSEQFRDASKILVDALQKFADDMYSLYGGNAVVELVTVKSFDTSLIRKTRTILEAKQAKNPASPYNLAYKYNFEYSVVFN

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
ATP6AP2
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-90820. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml. For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com
Theoretical MW
33 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Renin R Recombinant Protein Antigen

  • APT6M8-9
  • ATP6AP2
  • ATP6IP2
  • ATP6M8-9
  • ATP6M8-9MRXE
  • ATPase H(+)-transporting lysosomal accessory protein 2
  • ATPase H(+)-transporting lysosomal-interacting protein 2
  • ATPase, H+ transporting, lysosomal accessory protein 2
  • ATPase, H+ transporting, lysosomal interacting protein 2
  • CAPER
  • ELDF10
  • Embryonic liver differentiation factor 10
  • ER-localized type I transmembrane adaptor
  • H+ transporting, lysosomal (vacuolar proton pump) membrane sectorassociated protein M8-9
  • HT028
  • M8-9
  • MGC99577
  • MRXE
  • MSTP009
  • N14F
  • Renin R
  • renin receptor
  • ReninR
  • vacuolar proton ATP synthase membrane sector associated protein M8-9
  • V-ATPase M8.9 subunit
  • XMRE

Background

Renin receptor encodes a protein which is associated with adenosine triphosphatases (ATPases). Proton-translocating ATPases have fundamental roles in energy conservation, secondary active transport, acidification of intracellular compartments, and cellular pH homeostasis. There are three classes of ATPases- F, P, and V. The vacuolar (V-type) ATPases have a transmembrane proton-conducting sector and an extramembrane catalytic sector. The encoded protein has been found associated with the transmembrane sector of the V-type ATPases.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-30027
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
MAB4447
Species: Hu
Applications: IHC, WB
AF1513
Species: Mu
Applications: CyTOF-ready, Flow, IHC, IP, Simple Western, WB
DAN00
Species: Hu
Applications: ELISA
NBP2-22203
Species: Hu, Pm, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
AF1230
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
PP-H4417-00
Species: Hu
Applications: DirELISA, IP, WB
AF2880
Species: Hu, Mu
Applications: WB
AF933
Species: Ha, Hu, Mu, Rt
Applications: Block, Flow, IHC, IP, Simple Western, WB
AF467
Species: Hu, Mu
Applications: CyTOF-ready, Flow, ICC, IHC, Simple Western, WB
NBP1-78444
Species: Hu, Mu, Pm, Rb, Rt
Applications: ICC/IF, IHC, IHC-P, Simple Western, WB
NBP1-77078
Species: Hu, Mu, Rb, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
DSE100
Species: Hu
Applications: ELISA
AF2944
Species: Hu
Applications: Simple Western, WB
NBP1-91258
Species: Bv, Ca, Eq, Fe, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
NBP1-90820PEP
Species: Hu
Applications: AC

Publications for Renin R Protein (NBP1-90820PEP) (0)

There are no publications for Renin R Protein (NBP1-90820PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Renin R Protein (NBP1-90820PEP) (0)

There are no reviews for Renin R Protein (NBP1-90820PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Renin R Protein (NBP1-90820PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Renin R Products

Research Areas for Renin R Protein (NBP1-90820PEP)

Find related products by research area.

Blogs on Renin R

There are no specific blogs for Renin R, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Renin R Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol ATP6AP2