RELT/TNFRSF19L Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: RELT/TNFRSF19L Antibody [NBP2-57601] - Staining of human cell line HaCaT shows localization to nucleus.

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

RELT/TNFRSF19L Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: TSSMVSEVKTITEAGPSWGDLPDSPQPGLPPEQQALLGSGGSRTKWLKPPAENKAEENRYVVRLSE
Specificity
Specificity of human RELT/TNFRSF19L antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (92%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
RELT
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
RELT/TNFRSF19L Recombinant Protein Antigen (NBP2-57601PEP)

Reactivity Notes

Rat 86%

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for RELT/TNFRSF19L Antibody

  • Receptor expressed in lymphoid tissues
  • RELT tumor necrosis factor receptor
  • RELT
  • TNFRSF19L
  • TNFRSF19LFLJ14993
  • tumor necrosis factor receptor superfamily member 19L
  • tumor necrosis factor receptor superfamily, member 19-like

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-48021
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-82929
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-32588
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-90886
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF3388
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready, Neut
NBP1-91725
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF723
Species: Mu
Applications: WB, IHC, ELISA(Cap), ELISA(Det), ELISA(Sta)
H00130497-Q01
Species: Hu
NBP1-85082
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-88419
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
MAB17761
Species: Hu, Mu, Rt
Applications: WB, ICC
NBP2-37568
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC
NB100-56583
Species: Hu, Rb
Applications: WB, Flow, IHC-P

Publications for RELT/TNFRSF19L Antibody (NBP2-57601) (0)

There are no publications for RELT/TNFRSF19L Antibody (NBP2-57601).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RELT/TNFRSF19L Antibody (NBP2-57601) (0)

There are no reviews for RELT/TNFRSF19L Antibody (NBP2-57601). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for RELT/TNFRSF19L Antibody (NBP2-57601) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for RELT/TNFRSF19L Antibody (NBP2-57601)

Discover related pathways, diseases and genes to RELT/TNFRSF19L Antibody (NBP2-57601). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RELT/TNFRSF19L Antibody (NBP2-57601)

Discover more about diseases related to RELT/TNFRSF19L Antibody (NBP2-57601).
 

Pathways for RELT/TNFRSF19L Antibody (NBP2-57601)

View related products by pathway.

PTMs for RELT/TNFRSF19L Antibody (NBP2-57601)

Learn more about PTMs related to RELT/TNFRSF19L Antibody (NBP2-57601).
 

Research Areas for RELT/TNFRSF19L Antibody (NBP2-57601)

Find related products by research area.

Blogs on RELT/TNFRSF19L

There are no specific blogs for RELT/TNFRSF19L, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our RELT/TNFRSF19L Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol RELT