REEP5 Antibody (3G11) - Azide and BSA Free

Sandwich ELISA: REEP5 Antibody (3G11) [H00007905-M04] - Detection limit for recombinant GST tagged REEP5 is 1 ng/ml as a capture antibody.

• Reactivity: Hu
• Applications: WB, ELISA
• Clone: 3G11
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

REEP5 Antibody (3G11) - Azide and BSA Free Summary

• Description: Quality control test: Antibody Reactive Against Recombinant Protein.
• Immunogen: C5orf18 (NP_005660, 113 a.a. ~ 184 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. KCGFLLWCMAPSPSNGAELLYKRIIRPFFLKHESQMDSVVKDLKDKAKETADAITKEAKKATVNLLGEEKKS
• Specificity: C5orf18 - chromosome 5 open reading frame 18 (3G11)
• Isotype: IgG2a Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: REEP5
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Sandwich ELISA
  • Western Blot
• Application Notes: Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for REEP5 Antibody (3G11) - Azide and BSA Free

• C5orf18polyposis coli region hypothetical protein DP1
• chromosome 5 open reading frame 18
• D5S346deleted in polyposis 1
• DP1TB2YOP1
• MGC70440
• Polyposis locus protein 1
• Protein TB2
• receptor accessory protein 5
• receptor expression enhancing protein 5
• receptor expression-enhancing protein 5

Background

REEP5 may promote functional cell surface expression of olfactory receptors

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: REEP5
• Entrez:
  • 7905(Human)
• Uniprot:
  • NP_005660(Human)