Recombinant Human RECK Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human RECK Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 701-800 of Human RECK partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:KFGCSQYECVPRQLACDQVQDPVCDTDHMEHNNLCTLYQRGKSLSYKGPCQPFCRATEPVCGHNGETYSSVCAAYSDRVAVDYYGDCQAVGVLSEHSSVA

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
RECK

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human RECK Protein

  • hRECK
  • membrane-anchored glycoprotein (metastasis and invasion)
  • RECK
  • reversion-inducing-cysteine-rich protein with kazal motifs
  • ST15
  • ST15reversion-inducing cysteine-rich protein with Kazal motifs
  • suppression of tumorigenicity 15 (reversion-inducing-cysteine-rich protein withkazal motifs)
  • suppression of tumorigenicity 5 (reversion-inducing-cysteine-rich protein withkazal motifs)
  • Suppressor of tumorigenicity 15 protein

Background

RECK - reversion-inducing-cysteine-rich protein with kazal motifs

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB200-193
Species: Hu, Mu, Rt, Ch, GP
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
MAB9181
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
AF972
Species: Hu
Applications: WB, Simple Western, IHC
AF467
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
NBP2-46085
Species: Hu
Applications: WB, IHC
NB100-56519
Species: Hu, Mu, Rt, Po
Applications: WB, Simple Western, ChIP, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, IHC-FrFl

Publications for RECK Partial Recombinant Protein (H00008434-Q01) (0)

There are no publications for RECK Partial Recombinant Protein (H00008434-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RECK Partial Recombinant Protein (H00008434-Q01) (0)

There are no reviews for RECK Partial Recombinant Protein (H00008434-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for RECK Partial Recombinant Protein (H00008434-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional RECK Products

Bioinformatics Tool for RECK Partial Recombinant Protein (H00008434-Q01)

Discover related pathways, diseases and genes to RECK Partial Recombinant Protein (H00008434-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RECK Partial Recombinant Protein (H00008434-Q01)

Discover more about diseases related to RECK Partial Recombinant Protein (H00008434-Q01).
 

Pathways for RECK Partial Recombinant Protein (H00008434-Q01)

View related products by pathway.

PTMs for RECK Partial Recombinant Protein (H00008434-Q01)

Learn more about PTMs related to RECK Partial Recombinant Protein (H00008434-Q01).
 

Research Areas for RECK Partial Recombinant Protein (H00008434-Q01)

Find related products by research area.

Blogs on RECK

There are no specific blogs for RECK, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human RECK Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol RECK
Entrez