RCE1 Antibody

Images

 
Western Blot: RCE1 Antibody [NBP1-59922] - HepG2 cell lysate, Antibody Titration: 1.25ug/ml
Immunohistochemistry-Paraffin: RCE1 Antibody [NBP1-59922] - Human Muscle Tissue, Skeletal muscle cells (Indicated with Arrows) 4-8ug/ml.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

RCE1 Antibody Summary

Immunogen
Synthetic peptides corresponding to RCE1(RCE1 homolog, prenyl protein peptidase (S. cerevisiae)) The peptide sequence was selected from the N terminal of RCE1. Peptide sequence WARCLTDMRWLRNQVIAPLTEELVFRACMLPMLAPCMGLGPAVFTCPLFF.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
RCE1
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:10-1:500
Application Notes
This is a rabbit polyclonal antibody against RCE1 and was validated on Western Blot and immunohistochemistry-paraffin

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Protein A purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for RCE1 Antibody

  • CAAX prenyl protease 2
  • EC 3.4.22.-
  • FACE-2
  • FACE2RCE1 homolog, prenyl protein protease (S. cerevisiae)
  • farnesylated protein-converting enzyme 2
  • Farnesylated proteins-converting enzyme 2
  • hRCE1
  • Prenyl protein-specific endoprotease 2
  • RCE1 (S. Cerevisiae) homolog, prenyl protein protease
  • RCE1 homolog
  • RCE1 homolog, prenyl protein peptidase (S. cerevisiae)
  • RCE1 homolog, prenyl protein protease
  • RCE1A
  • RCE1B

Background

RCE1 is an integral membrane protein which is classified as a member of the metalloproteinase family. This enzyme is thought to function in the maintenance and processing of CAAX-type prenylated proteins.This gene encodes an integral membrane protein which is classified as a member of the metalloproteinase family. This enzyme is thought to function in the maintenance and processing of CAAX-type prenylated proteins.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-2387
Species: Hu, Mu, Ze
Applications: WB, ICC/IF
NBP1-91795
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-45745
Species: Hu
Applications: WB, IHC, IF
NBP1-83368
Species: Hu
Applications: WB, IHC, IHC-P
NB100-94887
Species: Hu, Rt
Applications: WB, IHC, IHC-P, PEP-ELISA
NBP1-47602
Species: Bv
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NB120-1868
Species: Hu, Mu
Applications: WB, IHC, IHC-Fr, IHC-P, IP
MAB3426
Species: Hu, Mu, Rt
Applications: WB, IHC
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-01462
Species: Hu
Applications: WB, Flow, ICC/IF
NBP1-31302
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89150
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
H00143384-B01P
Species: Hu
Applications: WB, ELISA
NBP1-85550
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-59922
Species: Hu
Applications: WB, IHC, IHC-P

Publications for RCE1 Antibody (NBP1-59922) (0)

There are no publications for RCE1 Antibody (NBP1-59922).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RCE1 Antibody (NBP1-59922) (0)

There are no reviews for RCE1 Antibody (NBP1-59922). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for RCE1 Antibody (NBP1-59922) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional RCE1 Products

Bioinformatics Tool for RCE1 Antibody (NBP1-59922)

Discover related pathways, diseases and genes to RCE1 Antibody (NBP1-59922). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RCE1 Antibody (NBP1-59922)

Discover more about diseases related to RCE1 Antibody (NBP1-59922).
 

Pathways for RCE1 Antibody (NBP1-59922)

View related products by pathway.

PTMs for RCE1 Antibody (NBP1-59922)

Learn more about PTMs related to RCE1 Antibody (NBP1-59922).

Blogs on RCE1

There are no specific blogs for RCE1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our RCE1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol RCE1
Uniprot