RBM8A Antibody (5K5E6) Summary
| Description |
Novus Biologicals Rabbit RBM8A Antibody (5K5E6) (NBP3-15805) is a recombinant monoclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Additional Information |
Recombinant Monoclonal Antibody |
| Immunogen |
A synthetic peptide corresponding to a sequence within amino acids 1-100 of human RBM8A (Q9Y5S9). MADVLDLHEAGGEDFAMDEDGDESIHKLKEKAKKRKGRGFGSEEGSRARMREDYDSVEQDGDEPGPQRSVEGWILFVTGVHEEATEEDIHDKFAEYGEIK |
| Source |
HEK293 |
| Isotype |
IgG |
| Clonality |
Monoclonal |
| Host |
Rabbit |
| Gene |
RBM8A |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Western Blot 1:500 - 1:2000
|
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.3), 50% glycerol, 0.05% BSA |
| Preservative |
0.02% Sodium Azide |
| Purity |
Affinity purified |
Alternate Names for RBM8A Antibody (5K5E6)
Background
Pre-mRNA splicing appears to play an important role in regulation of gene expression. It has been shown in a number of studies that during the splicing process, specific proteins are recruited to the mRNA and assemble into a complex of mRNA-protein near the exon-exon junction. This complex is termed mRNA-protein complex (mRNP), or the exon-exon junction complex. Several proteins were found to be present in this complex including Y14, magoh, Aly/REF, RNPS1, Upf3, and DEK. Y14 is a 174 amino acid RNA-binding protein that contains one RNA-binding domain in the middle of the protein. Y14 binds to the spliced mRNAs in the nucleus and is exported with the mRNA to the cytoplasm. Similar to other proteins in the mRNA-protein complex, Y14 can interact with the mRNA export factor TAP and enhance the export of the mRNAs. Y14 binds to different mRNAs approx.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu
Applications: IHC, IHC-P, WB
Species: Rt
Applications: WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Ba, Pp, Hu, I, Pm, Mu, Rt
Applications: ELISA, Func, ICC/IF, IHC, IHC-P, IP, KD, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, WB
Species: Hu, Mu, Rt
Applications: ChIP, CHIP-SEQ, ELISA, ICC/IF, IHC, IHC-P, IP, WB
Species: Bv, Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, KO, WB
Species: Mu
Applications: ICC, IHC, WB
Species: Hu
Applications: ELISA, ICC/IF, S-ELISA, WB
Species: Hu, Mu, Rt
Applications: ICC, KO, Simple Western, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P, IP, WB (-)
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ELISA
Publications for RBM8A Antibody (NBP3-15805) (0)
There are no publications for RBM8A Antibody (NBP3-15805).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for RBM8A Antibody (NBP3-15805) (0)
There are no reviews for RBM8A Antibody (NBP3-15805).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for RBM8A Antibody (NBP3-15805) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional RBM8A Products
Research Areas for RBM8A Antibody (NBP3-15805)
Find related products by research area.
|
Blogs on RBM8A