RBM5 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: RBM5 Antibody [NBP1-83305] - Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm.
Immunohistochemistry-Paraffin: RBM5 Antibody [NBP1-83305] - Staining of human stomach shows nuclear and cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

RBM5 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:WSSTQSQSGEGGSVDYSYLQPGQDGYAQYAQYSQDYQQFYQQQAGGLESDASSASGTAVTTTSAAVVSQSPQLYNQTSNPPGSPTEEAQPSTSTSTQAPAASPTGVVPGTKYAVPDTSTYQYDESSGYYY
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (95%), Rat (94%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
RBM5
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:20-1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Positive Control
Adrenal Lysate (NB820-59420)
Control Peptide
RBM5 Protein (NBP1-83305PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for RBM5 Antibody

  • G15
  • H37
  • LUCA15FLJ39876
  • Protein G15
  • Putative tumor suppressor LUCA15
  • Renal carcinoma antigen NY-REN-9
  • RMB5
  • RNA binding motif protein 5
  • RNA-binding motif protein 5
  • RNA-binding protein 5

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NLS4271
Species: Hu, Rt, Mk, Pm
Applications: WB, IHC-P, IF
NBP1-89376
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-84010
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-33480
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-32870
Species: Hu, Ch
Applications: WB, IHC, IHC-P, IP
NBP1-30943
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00063940-M01
Species: Hu
Applications: WB, ELISA
NB100-74413
Species: Hu, Mu, Rb
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB120-13550
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-91687
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
AF756
Species: Mu
Applications: WB, IHC
NBP2-57712
Species: Hu
Applications: ICC/IF
NBP1-89810
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-84951
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
H00009374-T01
Species: Hu
30230002
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
NBP1-76544
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ELISA, ICC/IF, IHC, IHC-P

Publications for RBM5 Antibody (NBP1-83305) (0)

There are no publications for RBM5 Antibody (NBP1-83305).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RBM5 Antibody (NBP1-83305) (0)

There are no reviews for RBM5 Antibody (NBP1-83305). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for RBM5 Antibody (NBP1-83305) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Positive Control Lysate(s)

Secondary Antibodies

 

Isotype Controls

Additional RBM5 Products

Bioinformatics Tool for RBM5 Antibody (NBP1-83305)

Discover related pathways, diseases and genes to RBM5 Antibody (NBP1-83305). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RBM5 Antibody (NBP1-83305)

Discover more about diseases related to RBM5 Antibody (NBP1-83305).
 

Pathways for RBM5 Antibody (NBP1-83305)

View related products by pathway.

PTMs for RBM5 Antibody (NBP1-83305)

Learn more about PTMs related to RBM5 Antibody (NBP1-83305).

Blogs on RBM5

There are no specific blogs for RBM5, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our RBM5 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol RBM5