RBM3 Antibody (4D6) - Azide and BSA Free

Immunocytochemistry/Immunofluorescence: RBM3 Antibody (4D6) [H00005935-M06] - Analysis of monoclonal antibody to RBM3 on HeLa cell. Antibody concentration 40 ug/ml

Immunohistochemistry-Paraffin: RBM3 Antibody (4D6) [H00005935-M06] - Analysis of monoclonal antibody to RBM3 on formalin-fixed paraffin-embedded human endometrium. Antibody concentration 3 ug/ml

ELISA: RBM3 Antibody (4D6) [H00005935-M06] - Detection limit for recombinant GST tagged RBM3 is 0.1 ng/ml as a capture antibody.

• Reactivity: Hu, Mu
• Applications: WB, ELISA, ICC/IF, IHC
• Clone: 4D6
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

RBM3 Antibody (4D6) - Azide and BSA Free Summary

• Description: Quality control test: Antibody Reactive Against Recombinant Protein.
• Immunogen: RBM3 (NP_006734.1, 1 a.a. ~ 80 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MSSEEGKLFVGGLNFNTDEQALEDHFSSFGPISEVVVVKDRETQRSRGFGFITFTNPEHASVAMRAMNGESLDGRQIRVD
• Specificity: Reacts with RNA binding motif (RNP1, RRM) protein 3.
• Isotype: IgG1 Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: RBM3
• Purity: Protein A purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunocytochemistry/ Immunofluorescence
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
  • Western Blot
• Application Notes: This antibody is reactive against recombinant protein in WB and ELISA.

Reactivity Notes

Mouse reactivity reported in scientific literature (PMID: 20585313).

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: Protein A purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for RBM3 Antibody (4D6) - Azide and BSA Free

• IS1-RNPL
• putative RNA-binding protein 3
• RNA binding motif (RNP1, RRM) protein 3
• RNA binding motif protein 3
• RNA-binding motif protein 3
• RNPL

Background

This gene is a member of the glycine-rich RNA-binding protein family and encodes a protein with one RNA recognition motif (RRM) domain. Expression of this gene is induced by cold shock and low oxygen tension. A pseudogene exists on chromosome 1. Multiple alternatively spliced transcript variants that are predicted to encode different isoforms have been characterized although some of these variants fit nonsense-mediated decay (NMD) criteria. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for RBM3 Antibody (H00005935-M06)(2)

Publications using H00005935-M06

• Zhang HT, Zhang ZW, Xue JH et al. Differential expression of the RNA-binding motif protein 3 in human astrocytoma. Chin Med J (Engl). 2013-05-01 [PMID: 23673116]
• Frey Mark R, Hilliard Valda C, Mullane Matthew T, Polk D Brent. ErbB4 promotes cyclooxygenase-2 expression and cell survival in colon epithelial cells. Lab Invest 2010-01-01 [PMID: 20585313] (WB, Mouse)

Bioinformatics

• Gene Symbol: RBM3
• Entrez:
  • 5935(Human)
• Uniprot:
  • NP_006734(Human)