RBM28 Recombinant Protein Antigen

Images

 
There are currently no images for RBM28 Recombinant Protein Antigen (NBP2-54998PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

RBM28 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to RBM28.

Source: E. coli

Amino Acid Sequence: ENDDDDDDDDEEDGVFDDEDEEEENIESKVTKPVQIQKRAVKRPAPAKSSDHSEEDSDLEESDSIDDGEELAQSDTSTEEQEDKAVQVSNKKKRKLPSDVNEGKTVFIRNLSFDSEEEE

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
RBM28
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-54998.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
31 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for RBM28 Recombinant Protein Antigen

  • FLJ10377
  • RNA binding motif protein 28
  • RNA-binding motif protein 28,2810480G15Rik
  • RNA-binding protein 28

Background

The protein encoded by the RBM28 gene is a specific nucleolar component of the spliceosomal small nuclear ribonucleoprotein (snRNP)complexes . It specifically associates with U1, U2, U4, U5, and U6 small nuclear RNAs (snRNAs), possibly coordinating their transition through the nucleolus. Mutation in this gene causes alopecia, progressive neurological defects, and endocrinopathy (ANE syndrome), a pleiotropic and clinically heterogeneous disorder. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. (provided by RefSeq)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB600-231
Species: Hu
Applications: IHC,  IHC-P, KD, WB
NBP2-31642
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, KD, WB
NBP3-41243
Species: Hu
Applications: IHC,  IHC-P, WB
AF1445
Species: Mu, Rt
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), IHC, Neut, Simple Western, WB
AF3757
Species: Hu
Applications: ICC, Simple Western, WB
NBP1-82563
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-90927
Species: Hu
Applications: IHC,  IHC-P, WB
NB500-106
Species: Ch, Dr, Fi, Hu, Mar, Mu, Po, Pm, Rb, Rt, Ye, Ze
Applications: ChIP, ChIP, ELISA, Flow, ICC/IF, IHC-FrFl, IHC, IHC-Fr,  IHC-P, IP, Simple Western, WB
AF1329
Species: Hu, Mu, Rt
Applications: ChIP, CyTOF-ready, ICC, IHC, ICFlow, Simple Western, WB
NBP2-14886
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, WB
291-G1
Species: Hu
Applications: BA
NBP3-32621
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
NBP2-34014
Species: Hu
Applications: IHC,  IHC-P
NB100-1533
Species: Hu, Mu, Po, Rt, Sh
Applications: Flow, ICC/IF, IHC,  IHC-P, PEP-ELISA, WB
AF1067
Species: Hu, Mu, Rt
Applications: ELISA, IHC, Neut, WB

Publications for RBM28 Recombinant Protein Antigen (NBP2-54998PEP) (0)

There are no publications for RBM28 Recombinant Protein Antigen (NBP2-54998PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RBM28 Recombinant Protein Antigen (NBP2-54998PEP) (0)

There are no reviews for RBM28 Recombinant Protein Antigen (NBP2-54998PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for RBM28 Recombinant Protein Antigen (NBP2-54998PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional RBM28 Products

Blogs on RBM28

There are no specific blogs for RBM28, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our RBM28 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol RBM28