We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

RBM25 Recombinant Protein Antigen

Images

 
There are currently no images for RBM25 Recombinant Protein Antigen (NBP2-57656PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

RBM25 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human RBM25.

Source: E. coli

Amino Acid Sequence: FPPPVPPGTPMIPVPMSIMAPAPTVLVPTVSMVGKHLGARKDHPGLKAKENDENCGPTTTVFVGNISEKASDMLIRQLLAKCGLVLSW

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
RBM25
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-57656.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
27 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for RBM25 Recombinant Protein Antigen

  • Arg/Glu/Asp-rich protein of 120 kDa
  • Arg/Glu/Asp-rich protein, 120 kDa
  • fSAP94
  • functional spliceosome-associated protein 94
  • MGC105088
  • MGC117168
  • NET52
  • Protein S164
  • RED120RNA-binding region-containing protein 7
  • RNA binding motif protein 25
  • RNA-binding motif protein 25
  • RNA-binding protein 25
  • RNA-binding region (RNP1, RRM) containing 7
  • RNPC7
  • S164
  • Snu71
  • U1 small nuclear ribonucleoprotein 1SNRP homolog

Background

RBM25, also identified as hRED120 (for human Arg/Glu/Asp-rich protein of 120 kDa), contains an RNA recognition motif and a PWI nucleic acid binding domain and is suggested to have a role in RNA processing.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-13381
Species: Hu
Applications: Simple Western, WB
NBP1-88052
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
NBP1-84752
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
AF808
Species: Mu
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), ICC, IHC, Neut, WB
NBP2-52979
Species: Hu, Mu
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
H00004176-M01
Species: Hu
Applications: ELISA, ICC/IF, IHC,  IHC-P, PLA, WB
NB600-804
Species: Hu
Applications: IHC,  IHC-P, PEP-ELISA
NBP2-57100
Species: Hu
Applications: ICC/IF
NB600-717
Species: Bv
Applications: ELISA, ICC/IF, IHC, IHC-Fr,  IHC-P, RIA, RI, WB
NBP2-37962
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
NBP2-36776
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, KD, WB
NBP1-87933
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, Simple Western, WB
294-HG
Species: Hu
Applications: BA
NB600-922
Species: Ch, Mu
Applications: ELISA, IHC, Single-Cell Western, WB
NB100-288
Species: Hu, Mu
Applications: IHC,  IHC-P, IP, WB
AF800
Species: Hu, Mu
Applications: IP, Simple Western, WB
NBP2-16686
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, KO, WB
H00342184-M07
Species: Hu
Applications: ELISA, ICC/IF, WB

Publications for RBM25 Recombinant Protein Antigen (NBP2-57656PEP) (0)

There are no publications for RBM25 Recombinant Protein Antigen (NBP2-57656PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RBM25 Recombinant Protein Antigen (NBP2-57656PEP) (0)

There are no reviews for RBM25 Recombinant Protein Antigen (NBP2-57656PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for RBM25 Recombinant Protein Antigen (NBP2-57656PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional RBM25 Products

Array NBP2-57656PEP

Blogs on RBM25

There are no specific blogs for RBM25, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our RBM25 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol RBM25