RBM15 Antibody (3E2)

Images

 
Immunocytochemistry/ Immunofluorescence: RBM15 Antibody (3E2) [H00064783-M07] - Analysis of monoclonal antibody to RBM15 on HeLa cell. Antibody concentration 10 ug/ml
Sandwich ELISA: RBM15 Antibody (3E2) [H00064783-M07] - Detection limit for recombinant GST tagged RBM15 is 0.1 ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, ICC/IF, S-ELISA
Clone
3E2
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

RBM15 Antibody (3E2) Summary

Immunogen
RBM15 (NP_073605.4, 701 a.a. ~ 810 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. PIRDRRGSLEKSQGDKRDRKNSASAERDRKHRTTAPTEGKSPLKKEDRSDGSAPSTSTASSKLKSPSQKQDGGTAPVASASPKLCLAWQGMLLLKNSNFPSNMHLLQGDL
Specificity
Reacts with RNA binding motif protein 15.
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
RBM15
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
  • Immunocytochemistry/Immunofluorescence
  • Sandwich ELISA
  • Western Blot
Application Notes
This antibody is reactive against recombinant protein in western blot and ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
Protein A purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for RBM15 Antibody (3E2)

  • FLJ12479
  • one twenty two protein
  • one twenty-two
  • One-twenty two protein 1
  • putative RNA-binding protein 15
  • RNA binding motif protein 15
  • RNA-binding motif protein 15
  • SPEN

Background

Members of the SPEN (Split-end) family of proteins, including RBM15, have repressor function in several signaling pathways and may bind to RNA through interaction with spliceosome components (Hiriart et al., 2005 [PubMed 16129689]).[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-88498
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, KD, WB
NBP2-75563
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P, WB
NBP2-26245
Species: Hu, Mu
Applications: Flow, In vitro
NBP1-49045
Species: Mu, Rt
Applications: Cell Depl, CyTOF-ready, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, InhibTFunc
NBP2-45545
Species: Hu, Mu, Rt
Applications: IHC, WB
NBP1-81650
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-33427
Species: Hu
Applications: ChIP, ICC/IF, WB
NBP1-71927
Species: Hu
Applications: ICC/IF, IHC, IHC-P, IP, WB
NBP2-20648
Species: Hu, Mu, Rt
Applications: ELISA, IHC, IHC-P, WB
NBP1-31649
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-82956
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
DMP900
Species: Hu
Applications: ELISA
MAB4540
Species: Hu, Mu, Rt
Applications: IHC, WB
MAB1419
Species: Hu, Rt
Applications: CyTOF-ready, ICC, IHC, ICFlow
AF467
Species: Hu, Mu
Applications: CyTOF-ready, Flow, ICC, IHC, Simple Western, WB
NBP2-67360
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, IP, WB
NBP1-85445
Species: Hu
Applications: IHC, IHC-P, WB
H00064783-M07
Species: Hu
Applications: WB, ELISA, ICC/IF, S-ELISA

Publications for RBM15 Antibody (H00064783-M07) (0)

There are no publications for RBM15 Antibody (H00064783-M07).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RBM15 Antibody (H00064783-M07) (0)

There are no reviews for RBM15 Antibody (H00064783-M07). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for RBM15 Antibody (H00064783-M07) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional RBM15 Products

Bioinformatics Tool for RBM15 Antibody (H00064783-M07)

Discover related pathways, diseases and genes to RBM15 Antibody (H00064783-M07). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RBM15 Antibody (H00064783-M07)

Discover more about diseases related to RBM15 Antibody (H00064783-M07).
 

Pathways for RBM15 Antibody (H00064783-M07)

View related products by pathway.

PTMs for RBM15 Antibody (H00064783-M07)

Learn more about PTMs related to RBM15 Antibody (H00064783-M07).

Blogs on RBM15

There are no specific blogs for RBM15, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our RBM15 Antibody (3E2) and receive a gift card or discount.

Bioinformatics

Gene Symbol RBM15
Entrez
Uniprot