RBM15 Antibody (2C1)

Images

 
Sandwich ELISA: RBM15 Antibody (2C1) [H00064783-M19] - Detection limit for recombinant GST tagged RBM15 is 0.1 ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ELISA
Clone
2C1
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

RBM15 Antibody (2C1) Summary

Immunogen
RBM15 (NP_073605.4, 701 a.a. ~ 810 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. PIRDRRGSLEKSQGDKRDRKNSASAERDRKHRTTAPTEGKSPLKKEDRSDGSAPSTSTASSKLKSPSQKQDGGTAPVASASPKLCLAWQGMLLLKNSNFPSNMHLLQGDL
Specificity
RBM15 - RNA binding motif protein 15 (2C1)
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
RBM15
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
  • Sandwich ELISA
Application Notes
This product is useful for ELISA.
Publications
Read Publication using H00064783-M19.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for RBM15 Antibody (2C1)

  • FLJ12479
  • one twenty two protein
  • one twenty-two
  • One-twenty two protein 1
  • putative RNA-binding protein 15
  • RNA binding motif protein 15
  • RNA-binding motif protein 15
  • SPEN

Background

Members of the SPEN (Split-end) family of proteins, including RBM15, have repressor function in several signalingpathways and may bind to RNA through interaction with spliceosome components (Hiriart et al., 2005 (PubMed16129689)).(supplied by OMIM)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-88498
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, KD, WB
NBP2-22522
Species: Hu, Mu, Rt, Xp
Applications: WB
NBP2-26245
Species: Hu, Mu
Applications: Flow, In vitro
NBP1-49045
Species: Mu, Rt
Applications: Cell Depl, CyTOF-ready, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, InhibTFunc
NBP2-45545
Species: Hu, Mu, Rt
Applications: IHC, WB
NBP1-81650
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-33427
Species: Hu
Applications: ChIP, ICC/IF, WB
NBP3-13785
Species: Hu
Applications: ELISA, Flow, ICC/IF, IHC-P, IP, PA, WB
DTPA00
Species: Hu
Applications: ELISA
NBP1-31649
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-82956
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
DMP900
Species: Hu
Applications: ELISA
MAB4540
Species: Hu, Mu, Rt
Applications: IHC, WB
MAB1419
Species: Hu, Rt
Applications: CyTOF-ready, ICC, IHC, ICFlow
AF467
Species: Hu, Mu
Applications: CyTOF-ready, Flow, ICC, IHC, Simple Western, WB
MAB1230
Species: Hu, Mu, Rt
Applications: ICC, IHC, KO, Simple Western, WB
NBP1-85445
Species: Hu
Applications: IHC, IHC-P
H00064783-M19
Species: Hu
Applications: ELISA

Publications for RBM15 Antibody (H00064783-M19)(1)


Showing Publication 1 - 1 of 1.
Publication using H00064783-M19 Applications Species
Halbert D, Domenyuk V, Spetzler D et al. Aptamers and uses thereof United States Patent Application US 9958448 B2 2018-01-01

Reviews for RBM15 Antibody (H00064783-M19) (0)

There are no reviews for RBM15 Antibody (H00064783-M19). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for RBM15 Antibody (H00064783-M19) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our RBM15 Antibody (2C1) and receive a gift card or discount.

Bioinformatics

Gene Symbol RBM15
Entrez
Uniprot