RBBP4/RbAp48 Antibody (0D1X1)

Western Blot: RBBP4/RbAp48 Antibody (0D1X1) [NBP3-16237] - Western blot analysis of extracts of various cell lines, using RBBP4/RbAp48 Rabbit mAb (NBP3-16237) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 3s.

Immunocytochemistry/ Immunofluorescence: RBBP4/RbAp48 Antibody (0D1X1) [NBP3-16237] - Confocal imaging of NIH/3T3 cells using RBBP4/RbAp48 Rabbit mAb. The cells were counterstained with alpha-Tubulin Mouse mAb (Green). DAPI was used for nuclear staining (blue). Objective: 100x.

Immunocytochemistry/ Immunofluorescence: RBBP4/RbAp48 Antibody (0D1X1) [NBP3-16237] - Confocal imaging of U-2 OS cells using RBBP4/RbAp48 Rabbit mAb. The cells were counterstained with alpha-Tubulin Mouse mAb (Green). DAPI was used for nuclear staining (blue). Objective: 100x.

Immunohistochemistry-Paraffin: RBBP4/RbAp48 Antibody (0D1X1) [NBP3-16237] - Immunohistochemistry of paraffin-embedded mouse brain using RBBP4/RbAp48 Rabbit mAb (NBP3-16237) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

Immunohistochemistry-Paraffin: RBBP4/RbAp48 Antibody (0D1X1) [NBP3-16237] - Immunohistochemistry of paraffin-embedded rat brain using RBBP4/RbAp48 Rabbit mAb (NBP3-16237) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

Immunohistochemistry-Paraffin: RBBP4/RbAp48 Antibody (0D1X1) [NBP3-16237] - Immunohistochemistry of paraffin-embedded human lung cancer using RBBP4/RbAp48 Rabbit mAb (NBP3-16237) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

Immunohistochemistry: RBBP4/RbAp48 Antibody (0D1X1) [NBP3-16237] - Immunohistochemistry analysis of paraffin-embedded human breast cancer using RBBP4/RbAp48 Rabbit mAb at dilution of 1:200 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

Immunohistochemistry: RBBP4/RbAp48 Antibody (0D1X1) [NBP3-16237] - Immunohistochemistry analysis of paraffin-embedded human tonsil using RBBP4/RbAp48 Rabbit mAb at dilution of 1:200 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

Immunohistochemistry: RBBP4/RbAp48 Antibody (0D1X1) [NBP3-16237] - Immunohistochemistry analysis of paraffin-embedded human thyroid cancer using RBBP4/RbAp48 Rabbit mAb at dilution of 1:200 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

Immunohistochemistry: RBBP4/RbAp48 Antibody (0D1X1) [NBP3-16237] - Immunohistochemistry analysis of paraffin-embedded rat kidney using RBBP4/RbAp48 Rabbit mAb at dilution of 1:200 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

Immunohistochemistry: RBBP4/RbAp48 Antibody (0D1X1) [NBP3-16237] - Immunohistochemistry analysis of paraffin-embedded human colon carcinoma using RBBP4/RbAp48 Rabbit mAb at dilution of 1:200 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

Immunohistochemistry: RBBP4/RbAp48 Antibody (0D1X1) [NBP3-16237] - Immunohistochemistry analysis of paraffin-embedded human placenta using RBBP4/RbAp48 Rabbit mAb at dilution of 1:200 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

Immunohistochemistry: RBBP4/RbAp48 Antibody (0D1X1) [NBP3-16237] - Immunohistochemistry analysis of paraffin-embedded human kidney using RBBP4/RbAp48 Rabbit mAb at dilution of 1:200 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

Immunohistochemistry: RBBP4/RbAp48 Antibody (0D1X1) [NBP3-16237] - Immunohistochemistry analysis of paraffin-embedded human colon using RBBP4/RbAp48 Rabbit mAb at dilution of 1:200 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

Immunohistochemistry: RBBP4/RbAp48 Antibody (0D1X1) [NBP3-16237] - Immunohistochemistry analysis of paraffin-embedded human liver using RBBP4/RbAp48 Rabbit mAb at dilution of 1:200 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

Immunohistochemistry: RBBP4/RbAp48 Antibody (0D1X1) [NBP3-16237] - Immunohistochemistry analysis of paraffin-embedded mouse liver using RBBP4/RbAp48 Rabbit mAb at dilution of 1:200 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

Immunohistochemistry: RBBP4/RbAp48 Antibody (0D1X1) [NBP3-16237] - Immunohistochemistry analysis of paraffin-embedded mouse intestin using RBBP4/RbAp48 Rabbit mAb at dilution of 1:200 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF, IHC
• Clone: 0D1X1
• Clonality: Monoclonal
• Host: Rabbit
• Conjugate: Unconjugated

RBBP4/RbAp48 Antibody (0D1X1) Summary

• Description: Novus Biologicals Rabbit RBBP4/RbAp48 Antibody (0D1X1) (NBP3-16237) is a recombinant monoclonal antibody validated for use in IHC, WB and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Additional Information: Recombinant Monoclonal Antibody
• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1-100 of human RBBP4/RbAp48 (NP_005601.1). MADKEAAFDDAVEERVINEEYKIWKKNTPFLYDLVMTHALEWPSLTAQWLPDVTRPEGKDFSIHRLVLGTHTSDEQNHLVIASVQLPNDDAQFDASHYDS
• Source: HEK293
• Isotype: IgG
• Clonality: Monoclonal
• Host: Rabbit
• Gene: RBBP4
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 1:50 - 1:200
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin
  • Western Blot 1:500 - 1:1000

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol, 0.05% BSA
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for RBBP4/RbAp48 Antibody (0D1X1)

• CAF-1 p48
• CAF-1 subunit C
• CAF-1C
• CAF-I p48
• Chromatin assembly factor 1 subunit C
• Chromatin assembly factor I p48 subunit
• chromatin assembly factor/CAF-1 p48 subunit
• histone-binding protein RBBP4
• MSI1 protein homolog
• Nucleosome-remodeling factor subunit RBAP48
• NURF55
• RBAP48
• RBBP4
• RBBP-4
• retinoblastoma binding protein 4
• Retinoblastoma-binding protein 4CAF-I 48 kDa subunit
• Retinoblastoma-binding protein p48

Background

RbAp48 encodes a ubiquitously expressed nuclear protein which belongs to a highly conserved subfamily of WD-repeat proteins. It is present in protein complexes involved in histone acetylation and chromatin assembly. It is part of the Mi-2 complex which has been implicated in chromatin remodeling and transcriptional repression associated with histone deacetylation. This encoded protein is also part of co-repressor complexes, which is an integral component of transcriptional silencing. It is found among several cellular proteins that bind directly to retinoblastoma protein to regulate cell proliferation. This protein also seems to be involved in transcriptional repression of E2F-responsive genes.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: RBBP4