RASA3 Antibody

Images

 
Immunohistochemistry-Paraffin: RASA3 Antibody [NBP1-92316] - Staining of human colon shows strong cytoplasmic and nucleolar positivity in glandular cells.
Immunohistochemistry-Paraffin: RASA3 Antibody [NBP1-92316] - Staining of human colon shows strong cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

RASA3 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: LFNLYMSKLEKMQEACGSKSVYDGPEQEEYSTFVIDDPQETYKTLKQVIAGVGALEQEHAQYKRDKFKKTKYGSQE
Specificity
Specificity of human RASA3 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (95%), Rat (92%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
RASA3
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
RASA3 Protein (NBP1-92316PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for RASA3 Antibody

  • GAP1(IP4BP)
  • GAP1IP4BP
  • GAPIII
  • GTPase activating protein III
  • inositol 13,4,5-tetrakisphosphate-binding protein
  • Ins P4-binding protein
  • Ins(13,4,5)P4-binding protein
  • MGC46517
  • MGC47588
  • ras GTPase-activating protein 3
  • RAS p21 protein activator 3

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-32870
Species: Hu, Ch
Applications: WB, IHC, IHC-P, IP, KD
NBP2-02300
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NBP1-89794
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-84957
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-65538
Species: Hu
NBP1-89794
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-13203
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
AF5094
Species: Hu, Mu, Rt
Applications: WB
NBP1-52084
Species: Hu, Mu, Rt
Applications: WB, IHC-P, PEP-ELISA
H00005706-M02
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, RNAi
NBP1-32776
Species: Hu
Applications: WB, ICC/IF
NBP1-89334
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00201780-P01
Species: Hu
NBP2-34014
Species: Hu
Applications: IHC, IHC-P
NBP2-32482
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-83002
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
NBP1-92316
Species: Hu, Mu, Rt
Applications: IHC, IHC-P

Publications for RASA3 Antibody (NBP1-92316) (0)

There are no publications for RASA3 Antibody (NBP1-92316).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RASA3 Antibody (NBP1-92316) (0)

There are no reviews for RASA3 Antibody (NBP1-92316). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for RASA3 Antibody (NBP1-92316) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for RASA3 Antibody (NBP1-92316)

Discover related pathways, diseases and genes to RASA3 Antibody (NBP1-92316). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RASA3 Antibody (NBP1-92316)

Discover more about diseases related to RASA3 Antibody (NBP1-92316).
 

Pathways for RASA3 Antibody (NBP1-92316)

View related products by pathway.

PTMs for RASA3 Antibody (NBP1-92316)

Learn more about PTMs related to RASA3 Antibody (NBP1-92316).
 

Research Areas for RASA3 Antibody (NBP1-92316)

Find related products by research area.

Blogs on RASA3

There are no specific blogs for RASA3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our RASA3 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol RASA3