RAR beta/NR1B2 Antibody (6D5V4) Summary
| Additional Information |
Recombinant Monoclonal Antibody |
| Immunogen |
A synthetic peptide corresponding to a sequence within amino acids 350-455 of human RAR beta/NR1B2 (NP_000956.2). KLQEPLLEALKIYIRKRRPSKPHMFPKILMKITDLRSISAKGAERVITLKMEIPGSMPPLIQEMLENSEGHEPLTPSSSGNTAEHSPSISPSSVENSGVSQSPLVQ |
| Source |
HEK293 |
| Isotype |
IgG |
| Clonality |
Monoclonal |
| Host |
Rabbit |
| Gene |
RARB |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- ELISA Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements.
- Immunocytochemistry/ Immunofluorescence 1:50 - 1:200
- Western Blot 1:1000 - 1:4000
|
| Theoretical MW |
50 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.3), 50% glycerol, 0.05% BSA |
| Preservative |
0.02% Sodium Azide |
| Purity |
Affinity purified |
Alternate Names for RAR beta/NR1B2 Antibody (6D5V4)
Background
Retinoids can reverse various premalignant lesions as well as prevent some second primary tumors. The effects of retinoids are regulated by retinoic acid receptors (RAR) and retinoid X receptors, which act as ligand-activated transcription factors. Ligand-dependent transcriptional activation of RARs is a multistep process that ends with the formation of a multimeric co-activator complex on regulated promoters (1,2). Loss of RAR-beta expression and the accumulation of p53 and Ki67 proteins may help in the early identification of esophageal cancer in high-risk populations (3).
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu
Applications: WB
Species: Hu
Applications: ELISA, IHC, WB
Species: Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, Simple Western, WB
Species: Hu, Mu
Applications: CyTOF-ready, Dual ISH-IHC, Flow, ICC, IHC, Simple Western, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Mu
Applications: IP, WB
Species: Pm, Hu, Pm, Mu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu(-)
Applications: CyTOF-ready, Flow-IC, Flow, ICC/IF, IHC, IHC-P, Simple Western, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
Species: Av, Bv, Ma, Hu, Mu, Pm, Rt
Applications: IF, IHC, IHC-Fr, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
Publications for RAR beta/NR1B2 Antibody (NBP3-16428) (0)
There are no publications for RAR beta/NR1B2 Antibody (NBP3-16428).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for RAR beta/NR1B2 Antibody (NBP3-16428) (0)
There are no reviews for RAR beta/NR1B2 Antibody (NBP3-16428).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for RAR beta/NR1B2 Antibody (NBP3-16428). (Showing 1 - 1 of 1 FAQ).
-
I am planning to perform IHC staining of RARB on FFPE samples. I have found the reference "J Cutan Pathol 2009;36; 1141-1145" used an antibody from your company. Would you let me know any other references using the antibody for IHC staining of RARB?
- Unfortunately we are not aware of any other publication wherein our Retinoic Acid Receptor beta antibodies were cited for their use in IHC application. From our sales records, it looks like the researcher used catalog number NB200-323 in the publication you mentioned. Retinoic Acid Receptor beta antibody NB200-323 is our best selling product among this category and it has also been cited for its use in WB application by Yang et al. in Am J Physiol Renal Physiol. 2008 Jun;294(6):F1433-40. We have at least 7 primary antibody products to Retinoic Acid Receptor beta that have been validated for IHC-P application.. We stand behind the quality of our products and offer 100% guarantee for the applications/species mentioned on the datasheets. We are always there to help if you come up with any difficulties and yes, we provide replacements/refunds after troubleshooting a problem, if you do not get your desired outcome! Therefore, please let us know if you have any specific questions or concerns on the IHC-P application of our Retinoic Acid Receptor beta antibodies. You may contact us at technical@novusbio.com.
Secondary Antibodies
| |
Isotype Controls
|
Additional RAR beta/NR1B2 Products
Research Areas for RAR beta/NR1B2 Antibody (NBP3-16428)
Find related products by research area.
|
Blogs on RAR beta/NR1B2