| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Format | BSA Free |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: MECCEESMKIALQHGDRPLQALCLLCFADIHRSRGDLETAFPRYDSAMSIMTEIGNRLGQVQALLGVAKCWVARKALDKALDAIE |
| Predicted Species | Mouse (94%), Rat (95%). Backed by our 100% Guarantee. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | RAPSN |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Affinity purified |
| Publications using NBP1-85537 | Applications | Species |
|---|---|---|
| Jühlen R, Martinelli V, Rencurel C, Fahrenkrog B Alteration of actin cytoskeletal organisation in fetal akinesia deformation sequence bioRxiv 2023-06-12 (ICC/IF, Human) | ICC/IF | Human |
| Ramona Jühlen, Lukas Grauer, Valérie Martinelli, Chantal Rencurel, Birthe Fahrenkrog Alteration of actin cytoskeletal organisation in fetal akinesia deformation sequence. Scientific reports 2024-01-22 [PMID: 38242956] | ||
| Bonnin E, Cabochette P, Filosa A et al. Biallelic mutations in nucleoporin NUP88 cause lethal fetal akinesia deformation sequence PLoS Genet. [PMID: 30543681] (WB, IF/IHC, Human) | WB, IF/IHC | Human |
| Juhlen R, Breckpot J, Fahrenkrog B Centrosome and ciliary abnormalities in fetal akinesia deformation sequence human fibroblasts bioRxiv (ICC/IF) | ICC/IF | |
| Juhlen R, Breckpot J, Fahrenkrog B Centrosome and ciliary abnormalities in fetal akinesia deformation sequence human fibroblasts Sci Rep 2020-11-10 [PMID: 33168876] |
Secondary Antibodies |
Isotype Controls |
Research Areas for Rapsyn Antibody (NBP1-85537)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | RAPSN |