RAPGEF2 Antibody (1E8) - Azide and BSA Free

Sandwich ELISA: RAPGEF2 Antibody (1E8) [H00009693-M01] - Detection limit for recombinant GST tagged RAPGEF2 is approximately 0.1ng/ml as a capture antibody.

• Reactivity: Hu, Mu
• Applications: WB, ELISA, IP
• Clone: 1E8
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

RAPGEF2 Antibody (1E8) - Azide and BSA Free Summary

• Immunogen: RAPGEF2 (XP_376350, 1398 a.a. ~ 1487 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. PITDFPEGHSHPARKPPDYNVALQRSRMVARSSDTAGPSSVQQPHGHPTSSRPVNKPQWHKPNESDPRLAPYQSQGFSTEEDEDEQVSAV
• Localization: Associated with the synaptic plasma membrane
• Specificity: RAPGEF2 - Rap guanine nucleotide exchange factor (GEF) 2
• Isotype: IgG1 Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: RAPGEF2
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunoprecipitation
  • Sandwich ELISA
  • Western Blot 1:500
• Application Notes: Antibody reactive against recombinant protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.

Reactivity Notes

Human. Other species not tested.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for RAPGEF2 Antibody (1E8) - Azide and BSA Free

• CNrasGEF
• KIAA0313
• Neural RAP guanine nucleotide exchange protein
• nRap GEP
• NRAPGEP
• PDZ domain containing guanine nucleotide exchange factor (GEF) 1
• PDZGEF1
• PDZ-GEF1PDZ domain-containing guanine nucleotide exchange factor 1
• RA(Ras/Rap1A-associating)-GEF
• RA-GEFDKFZP586O1422
• Rap guanine nucleotide exchange factor (GEF) 2
• rap guanine nucleotide exchange factor 2
• Rap-GEP

Background

Members of the RAS (see HRAS; MIM 190020) subfamily of GTPases function in signal transduction as GTP/GDP-regulated switches that cycle between inactive GDP- and active GTP-bound states. Guanine nucleotide exchange factors (GEFs), such as RAPGEF2, serve as RAS activators by promoting acquisition of GTP to maintain the active GTP-bound state and are the key link between cell surface receptors and RAS activation (Rebhun et al., 2000 [PubMed 10934204]).[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for RAPGEF2 Antibody (H00009693-M01)(3)

Publications using H00009693-M01

• Gloerich M, Ten Klooster JP, Vliem MJ et al. Rap2A links intestinal cell polarity to brush border formation. Nat Cell Biol. 2012-07-15 [PMID: 22797597]
• Pannekoek WJ, van Dijk JJ, Chan OY et al. Epac1 and PDZ-GEF cooperate in Rap1 mediated endothelial junction control. Cell Signal. 2011-08-04 [PMID: 21840392]
• Letschka T, Kollmann V, Pfeifhofer-Obermair C et al. PKC{theta} selectively controls the adhesion-stimulating molecule Rap1. Blood;112(12):4617-27. 2008-12-01 [PMID: 18796635]

Bioinformatics

• Gene Symbol: RAPGEF2
• Entrez:
  • 9693(Human)
• OMIM:
  • 609530(Human)
• Uniprot:
  • XP_376350(Human)