Rap2A Antibody

Product Discontinued

Rap2A Antibody Summary

• Immunogen: The immunogen for this antibody is RAP2A - C-terminal region. Peptide sequence QIIRVKRYEKVPVILVGNKVDLESEREVSSSEGRALAEEWGCPFMETSAK.
• Predicted Species: Mouse (93%), Rat (93%), Sheep (93%), Canine (93%), Bovine (93%), Equine (93%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: RAP2A
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1:1000
• Theoretical MW: 20 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS and 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Purity: Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for Rap2A Antibody

• KREV
• K-REV
• RAP2
• RAP2, member of RAS oncogene family (K-rev)
• Rap2A
• RAP2A, member of RAS oncogene family
• ras-related protein Rap-2a
• RbBP-30

Background

RAP2A is a small GTP-binding protein which cycles between a GDP-bound inactive and a GTP-bound active form. In its active form interacts with and regulates several effectors including MAP4K4, MINK1 and TNIK. Part of a signaling complex composed of NEDD4, RAP2A and TNIK which regulates neuronal dendrite extension and arborization during development. More generally, it is part of several signaling cascades and may regulate cytoskeletal rearrangements, cell migration, cell adhesion and cell spreading.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: RAP2A
• Uniprot:
  • NP_066361(Human)