RanBP2 Antibody


Immunocytochemistry/ Immunofluorescence: RanBP2 Antibody [NBP2-56520] - Staining of human cell line CACO-2 shows localization to nuclear membrane & vesicles.

Product Details

Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF

Order Details

RanBP2 Antibody Summary

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: LLLDIPLQTPHKLVDTGRAAKLIQRAEEMKSGLKDFK
Specificity of human RanBP2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (100%), Rat (100%). Backed by our 100% Guarantee.
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Affinity purified

Alternate Names for RanBP2 Antibody

  • ANE1
  • E3 SUMO-protein ligase RanBP2
  • EC
  • Nuclear pore complex protein Nup358
  • nucleoporin 358
  • Nucleoporin Nup358
  • NUP358TRP2
  • p270
  • RAN binding protein 2
  • Ran-binding protein 2
  • RanBP2
  • transformation-related protein 2,358 kDa nucleoporin
  • TRP1


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Rt, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Po, ChHa, Pm
Applications: WB, EM, ICC/IF, IHC, IHC-P, IP, KO
Species: Hu
Applications: WB, IHC, IHC-P
Species: Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Cell Depl, CyTOF-ready, InhibTFunc
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: ELISA, IHC, IHC-P
Species: Hu
Species: Hu
Applications: Flow, IF
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP
Species: Hu
Applications: WB, ICC/IF, IP, KO
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, IP
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P

Publications for RanBP2 Antibody (NBP2-56520) (0)

There are no publications for RanBP2 Antibody (NBP2-56520).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RanBP2 Antibody (NBP2-56520) (0)

There are no reviews for RanBP2 Antibody (NBP2-56520). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for RanBP2 Antibody (NBP2-56520) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Other Available Formats

Additional RanBP2 Products

Bioinformatics Tool for RanBP2 Antibody (NBP2-56520)

Discover related pathways, diseases and genes to RanBP2 Antibody (NBP2-56520). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RanBP2 Antibody (NBP2-56520)

Discover more about diseases related to RanBP2 Antibody (NBP2-56520).

Pathways for RanBP2 Antibody (NBP2-56520)

View related products by pathway.

PTMs for RanBP2 Antibody (NBP2-56520)

Learn more about PTMs related to RanBP2 Antibody (NBP2-56520).

Blogs on RanBP2

There are no specific blogs for RanBP2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our RanBP2 Antibody and receive a gift card or discount.


Gene Symbol RANBP2