RALGAPA2 Antibody - BSA Free

Immunohistochemistry-Paraffin: RALGAPA2 Antibody [NBP2-33399] - Staining of human testis shows nuclear and cytoplasmic positivity in cells in seminiferous ducts.

• Reactivity: Hu
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

RALGAPA2 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: SPAELDLKDDLQQTQGKCRERQKSESTNSDTTLGCTNEAELSMGPWQTCEEDPELNTPTDVVADADARHWLQLSPTDA
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: RALGAPA2
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  RALGAPA2 Protein (NBP2-33399PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for RALGAPA2 Antibody - BSA Free

• AS250KIAA1272akt substrate AS250
• bA287B20.1
• C20orf74
• chromosome 20 open reading frame 74
• dJ1049G11,250 kDa substrate of Akt
• dJ1049G11.4
• EC 2.7.2.11
• EC 5.3.4.1
• FLJ12819
• p220
• Ral GTPase activating protein, alpha subunit 2 (catalytic)
• ral GTPase-activating protein alpha subunit 2
• ral GTPase-activating protein subunit alpha-2
• RapGAPalpha2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: RALGAPA2
• Uniprot:
  • Q2PPJ7(Human)