Recombinant Human RAD54L Protein

Images

 
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, AP

Order Details

Recombinant Human RAD54L Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 638-747 of Human RAD54L

Source: Wheat Germ

Amino Acid Sequence: KKALSSCVVDEEQDVERHFSLGELKELFILDEASLSDTHDRLHCRRCVNSRQIRPPPDGSDCTSDLAGWNHCTDKWGLRDEVLQAAWDAASTAITFVFHQRSHEEQRGLR

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Source
Wheat germ
Protein/Peptide Type
Partial Recombinant Protein
Gene
RAD54L
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.
Theoretical MW
37.84 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human RAD54L Protein

  • EC 3.6.1
  • hHR54EC 3.6.4.-
  • HR54
  • hRAD54HRAD54
  • RAD54 (S.cerevisiae)-like
  • RAD54 homolog
  • RAD54ADNA repair and recombination protein RAD54-like
  • RAD54-like (S. cerevisiae)

Background

RAD54L - RAD54-like (S. cerevisiae)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-83077
Species: Hu
Applications: WB, IHC, IHC-P, KD
NB100-148
Species: Hu, Mu, Ce, Ch
Applications: WB, ChIP, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vitro
NBP2-58116
Species: Hu
Applications: ICC/IF
NBP1-83416
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89929
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-2594
Species: Hu, Mu
Applications: WB, ChIP, IHC, IHC-P, IP, PLA
NBP1-90015
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-22128
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC-P
MAB2476
Species: Hu
Applications: WB, IHC
NB100-619
Species: Hu
Applications: WB, IHC, IHC-P, IP
NBP2-16182
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-598
Species: Hu
Applications: WB, Flow, ICC/IF, IP, CyTOF-ready
NB100-1915
Species: Hu, Mu, Rt, Ha, Pm, Xp
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NB100-142
Species: Hu, Mu, Rt, Ch, Ha
Applications: WB, Simple Western, ChIP, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP2-61879
Species: Hu, Mu
Applications: WB, ELISA, Flow, IHC
NBP1-56408
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-2064
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IP, CyTOF-ready
NBP2-02667
Species: Hu, Rt, Ca, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB100-181
Species: Hu, Mu
Applications: WB, IP
NB100-104
Species: Hu, Mu
Applications: WB, ELISA, Flow, IB, ICC/IF, IHC, IHC-P, IP

Publications for RAD54L Partial Recombinant Protein (H00008438-Q01) (0)

There are no publications for RAD54L Partial Recombinant Protein (H00008438-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RAD54L Partial Recombinant Protein (H00008438-Q01) (0)

There are no reviews for RAD54L Partial Recombinant Protein (H00008438-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for RAD54L Partial Recombinant Protein (H00008438-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional RAD54L Products

Bioinformatics Tool for RAD54L Partial Recombinant Protein (H00008438-Q01)

Discover related pathways, diseases and genes to RAD54L Partial Recombinant Protein (H00008438-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RAD54L Partial Recombinant Protein (H00008438-Q01)

Discover more about diseases related to RAD54L Partial Recombinant Protein (H00008438-Q01).
 

Pathways for RAD54L Partial Recombinant Protein (H00008438-Q01)

View related products by pathway.

PTMs for RAD54L Partial Recombinant Protein (H00008438-Q01)

Learn more about PTMs related to RAD54L Partial Recombinant Protein (H00008438-Q01).
 

Research Areas for RAD54L Partial Recombinant Protein (H00008438-Q01)

Find related products by research area.

Blogs on RAD54L

There are no specific blogs for RAD54L, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Mre11 Antibody
NB100-142
RAD54L Antibody
NBP2-33916
ATM Antibody
NB100-104

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human RAD54L Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol RAD54L