Rad51D Antibody


Western Blot: Rad51D Antibody [NBP2-82330] - WB Suggested Anti-RAD51L3 Antibody. Titration: 1.0 ug/ml. Positive Control: Fetal Heart

Product Details

Reactivity HuSpecies Glossary
Applications WB

Order Details

Rad51D Antibody Summary

The immunogen is a synthetic peptide directed towards the C-terminal region of Human RAD51D. Peptide sequence: DTIEGAGASGGRRMACLAKSSRQPTGFQEMVDIGTWGTSEQSATLQGDQT The peptide sequence for this immunogen was taken from within the described region.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1.0 ug/ml
Theoretical MW
36 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS, 2% sucrose
0.09% Sodium Azide
Immunogen affinity purified

Alternate Names for Rad51D Antibody

  • DNA repair protein RAD51 homolog 4
  • HsTRAD
  • R51H3Trad
  • RAD51 homolog D
  • RAD51DRAD51 (S. cerevisiae)-like 3
  • RAD51-like 3 (S. cerevisiae)
  • RAD51-like protein 3
  • recombination repair protein
  • TRAD


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Ce, Ch, Hu, Mu, Rt
Applications: ChIP, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vitro, KD, PLA, WB
Species: Hu, Mu, Pm, Ye
Applications: CyTOF-ready, Flow, ICC/IF, IHC, IHC-P, IP, Simple Western, WB
Species: Hu
Applications: ICC/IF, IHC, IP, RIA, WB
Species: Hu, Mu(-), Pm
Applications: ICC/IF, WB
Species: Dr, Ha, Hu
Applications: ICC/IF (-), IP, WB
Species: Hu
Applications: IHC, WB
Species: Hu
Applications: ELISA, AP, PA, PAGE, WB
Species: Bv, Hu, Mu, Ma-Op, Pm, Rt
Applications: IHC, IHC-P, WB
Species: Hu, Mu
Applications: ChIP, ICC/IF, IHC, IHC-P, IP, WB
Species: Hu, Mu
Applications: IHC, IHC-P, IP, WB
Species: Hu, Mu
Applications: IP, WB
Species: Hu
Applications: IHC, WB
Species: Bv, Ca, Eq, Gt, Sh
Applications: Flow, IHC, IHC-Fr, IP
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: CyTOF-ready, Flow, ICC/IF, IP, WB
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
Species: Hu, Mu
Applications: IP, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KD, WB

Publications for Rad51D Antibody (NBP2-82330) (0)

There are no publications for Rad51D Antibody (NBP2-82330).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Rad51D Antibody (NBP2-82330) (0)

There are no reviews for Rad51D Antibody (NBP2-82330). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Rad51D Antibody (NBP2-82330) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional Rad51D Products

Bioinformatics Tool for Rad51D Antibody (NBP2-82330)

Discover related pathways, diseases and genes to Rad51D Antibody (NBP2-82330). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Rad51D Antibody (NBP2-82330)

Discover more about diseases related to Rad51D Antibody (NBP2-82330).

Pathways for Rad51D Antibody (NBP2-82330)

View related products by pathway.

PTMs for Rad51D Antibody (NBP2-82330)

Learn more about PTMs related to Rad51D Antibody (NBP2-82330).

Research Areas for Rad51D Antibody (NBP2-82330)

Find related products by research area.

Blogs on Rad51D

There are no specific blogs for Rad51D, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our Rad51D Antibody and receive a gift card or discount.


Gene Symbol RAD51D