Rad51D Antibody - BSA Free Summary
| Description |
Novus Biologicals Rabbit Rad51D Antibody - BSA Free (NBP2-82329) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen |
The immunogen is a synthetic peptide directed towards the C-terminal region of Human RAD51D. Peptide sequence: RLKPALGRSWSFVPSTRILLDTIEGAGASGGRRMACLAKSSRQPTGFQEM The peptide sequence for this immunogen was taken from within the described region. |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
RAD51D |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
|
| Theoretical MW |
34 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS, 2% Sucrose |
| Preservative |
0.09% Sodium Azide |
| Concentration |
0.5 mg/ml |
| Purity |
Affinity purified |
Alternate Names for Rad51D Antibody - BSA Free
Background
The Rad51 DNA repair protein is a key component of the double-strand break repair pathway and is essential for mitotic and meiotic recombination and genomic stability. Five human RAD51 homologues have been identified: XRCC2, XRCC3, RAD51B, RAD51C, and RAD51D. Each of these homologues interacts with one or more of the others, with all of the proteins involved with either one complex or with multiple smaller complexes. RAD51D interacts with XRCC2 and RAD51C (1). RAD51D's expression pattern and sequence similarity to other RAD51 family members most likely makes it part of a complex of proteins required for DNA repair and meiotic recombination.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Ch, Hu, Mu, Rt
Applications: ChIP, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vitro, KD, PLA, WB
Species: Hu, Mu, Pm, Ye
Applications: CyTOF-ready, Flow, ICC/IF, IHC, IHC-P, IP, Simple Western, WB
Species: Hu, Mu, Rt
Applications: ELISA, IHC, IHC-P, WB
Species: Hu, Mu(-), Pm
Applications: ICC/IF, WB
Species: Dr, Ha, Hu
Applications: ICC/IF (-), IP, WB
Species: Hu
Applications: IHC, WB
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, WB
Species: Bv, Hu, Mu, Ma-Op, Pm, Rt
Applications: IHC, IHC-P, WB
Species: Hu, Mu
Applications: ChIP, ICC/IF, IHC, IHC-P, IP, Simple Western, WB
Species: Hu, Mu
Applications: IHC, IHC-P, IP, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: CyTOF-ready, Flow
Species: Ca, Fe, Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: CyTOF-ready, Flow, ICC/IF, IP, WB
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
Species: Hu, Mu
Applications: IP, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KD, WB
Publications for Rad51D Antibody (NBP2-82329) (0)
There are no publications for Rad51D Antibody (NBP2-82329).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Rad51D Antibody (NBP2-82329) (0)
There are no reviews for Rad51D Antibody (NBP2-82329).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for Rad51D Antibody (NBP2-82329) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional Rad51D Products
Research Areas for Rad51D Antibody (NBP2-82329)
Find related products by research area.
|
Blogs on Rad51D