Rad51 Recombinant Protein Antigen

Images

 

Product Details

Summary
Product Discontinued
View other related Rad51 Peptides and Proteins

Order Details


    • Catalog Number
      NBP2-32622PEP
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Rad51 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human RAD51.

Source: E. coli

Amino Acid Sequence: MAMQMQLEANADTSVEEESFGPQPISRLEQCGINANDVKKLEEAGFHTVEAVAYAPKKELINIKGISEAKA

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
RAD51
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-32622.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
25 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Rad51 Recombinant Protein Antigen

  • BRCC5
  • HRAD51
  • HsRad51
  • HsT16930
  • RAD51 (S. cerevisiae) homolog (E coli RecA homolog)
  • RAD51 homolog (RecA homolog, E. coli) (S. cerevisiae)
  • RAD51 homolog A
  • Rad51
  • RAD51ABRCA1/BRCA2-containing complex, subunit 5
  • RAD51L3
  • RecA, E. coli, homolog of
  • RECADNA repair protein RAD51 homolog 1
  • RecA-like protein
  • recombination protein A

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-58116
Species: Hu
Applications: ICC/IF, KD
MAB2476
Species: Hu
Applications: IHC, WB
NB100-181
Species: Hu, Mu
Applications: IP, WB
NB100-404
Species: Hu
Applications: ChIP, ICC/IF, IHC,  IHC-P, IP, KD, KO, WB
NBP1-83077
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, KD, WB
NBP2-02667
Species: Ca, Hu, Pm, Mu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
NBP1-48002
Species: Ca, Hu, Pm, Pm
Applications: ICC/IF, IHC,  IHC-P, IP, WB
NB200-103
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, WB
NB100-165
Species: Dr, Ha, Hu
Applications: ICC/IF (-), IP, WB
NBP1-82449
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
NBP1-84037
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
NB100-309
Species: Hu, Pm, Mu, Rt
Applications: ChIP, ELISA, Flow, ICC/IF, IHC,  IHC-P, IP, KD, PAGE, Single-Cell Western, WB
AF4309
Species: Hu, Mu
Applications: ICC, IHC, WB
NB100-147
Species: Hu, Pm, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, IP, In vitro, KD, WB
NBP2-45731
Species: Ca, Hu, Pm
Applications: IHC,  IHC-P, WB
NBP3-35804
Species: Hu, Mu, Rt
Applications: ELISA, IHC,  IHC-P, WB

Publications for Rad51 Recombinant Protein Antigen (NBP2-32622PEP) (0)

There are no publications for Rad51 Recombinant Protein Antigen (NBP2-32622PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Rad51 Recombinant Protein Antigen (NBP2-32622PEP) (0)

There are no reviews for Rad51 Recombinant Protein Antigen (NBP2-32622PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Rad51 Recombinant Protein Antigen (NBP2-32622PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Rad51 Products

Research Areas for Rad51 Recombinant Protein Antigen (NBP2-32622PEP)

Find related products by research area.

Blogs on Rad51.

The recent relationship of BRCA1 and 53BP1
The p53-binding protein 1 (53BP1) is a DNA damage response factor, which is recruited to nuclear structures at the site of DNA damage.  DNA double-strand breaks (DSBs) are mutations that are detrimental to cell viability and genome stability, and m...  Read full blog post.

RAD51: The cell's 'Mr. Fix-it'
RAD51 is a recombinase protein encoded by RAD51 gene in humans. Human RAD51 family members are highly similar to bacterial RecA and yeast Rad51, both biochemically and structurally. It is a 339-amino acid protein that plays an important role in homolo...  Read full blog post.

NUP153 & 53BP1: A Novel DNA Repair Pathway
Mediating DNA damage is a crucial process, and one of the most important cellular guards against cancer. In response to DNA damage, sophisticated cellular machinery is recruited to repair the breaks, and if it fails, the cell is committed to death. De...  Read full blog post.

Determining DMC1's role in Homologus Recombination
The DMC1 gene encodes a 36.7 kDa nuclear protein involved in meiotic homologous recombination. This recombinase is functionally related to the yeast RAD51 and E. coli RecA genes. In contrast to RAD51, which functions in both mitotic and meiotic recomb...  Read full blog post.

Rad51 Antibody Reveals a Canine Model for Human Breast Cancer
Our antibody catalog includes an extensive range of Rad51 antibody reagents. Encoded by the RAD51 gene, the Rad51 protein plays a vital role in DNA repair, interacting with several other proteins, including BRCA1 and BRCA2, to effect homologous recomb...  Read full blog post.

Industrial Chemicals, Tumour Suppressor Genes and the Need for More Research
Human cancer research is the largest research area in our antibody database, with new oncogenes and cell lines being added all the time.Cancer triggers come from many sources, with a worrying amount of evidence to suggest that chemicals we’re in con...  Read full blog post.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Rad51 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol RAD51