RACK1/GNB2L1 Antibody


Western Blot: GNB2L1 Antibody [NBP1-58959] - Transfected 293T, Antibody Titration: 0.2-1 ug/ml
Immunohistochemistry-Paraffin: GNB2L1 Antibody [NBP1-58959] - Human small intestine tissue at an antibody concentration of 5ug/ml.

Product Details

Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P

Order Details

RACK1/GNB2L1 Antibody Summary

Synthetic peptides corresponding to GNB2L1(guanine nucleotide binding protein (G protein), beta polypeptide 2-like 1) The peptide sequence was selected from the N terminal of GNB2L1 (NP_006089). Peptide sequence ISSDGQFALSGSWDGTLRLWDLTTGTTTRRFVGHTKDVL
This product is specific to Subunit or Isoform: beta-2-like 1.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.2-1 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 5 ug/ml
Theoretical MW
35 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Read Publication using
NBP1-58959 in the following applications:

  • WB
    1 publication

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS & 2% Sucrose.
No Preservative
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for RACK1/GNB2L1 Antibody

  • GNB2L1
  • guanine nucleotide binding protein (G protein), beta polypeptide 2-like 1
  • guanine nucleotide binding
  • RACK1
  • Receptor for Activated C Kinase 1
  • Receptor for activated C kinase


GNB2L1 seems to bind protein kinase C acting as an intracellular receptor to anchor the activated PKC to the cytoskeleton. GNB2L1 may be involved in up-regulation of the activity of kinases such as PKC via binding to KRT1. Together with KRT1 and ITGB1, GNB2L1 serves as a platform for SRC activation or inactivation. GNB2L1 may play an important role in the developing brain and neuronal differentiation.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: WB, Simple Western, IHC
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow
Species: Hu, Mu, Rt, Po, Bv, Ft, Mk, Pm, Rb, Sh, Xp
Applications: WB, ChIP, ELISA, Flow, GS, ICC/IF, IHC, IHC-Fr, IHC-P, IP, PLA, TCS, KO, LA
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
Species: Hu, Mu
Applications: WB, B/N, ELISA, Flow, ICC/IF, IHC-Fr, IP
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Ca, Eq
Species: Hu
Applications: WB, IP
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC
Species: Hu, Mu, Rt, Fe, GP, Rb
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, IP, GS
Species: Hu
Applications: WB, IHC, IHC-P

Publications for RACK1/GNB2L1 Antibody (NBP1-58959)(1)

We have publications tested in 1 confirmed species: Invertebrate.

We have publications tested in 1 application: WB.

Filter By Application
All Applications
Filter By Species
All Species

Reviews for RACK1/GNB2L1 Antibody (NBP1-58959) (0)

There are no reviews for RACK1/GNB2L1 Antibody (NBP1-58959). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for RACK1/GNB2L1 Antibody (NBP1-58959) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional RACK1/GNB2L1 Products

Bioinformatics Tool for RACK1/GNB2L1 Antibody (NBP1-58959)

Discover related pathways, diseases and genes to RACK1/GNB2L1 Antibody (NBP1-58959). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RACK1/GNB2L1 Antibody (NBP1-58959)

Discover more about diseases related to RACK1/GNB2L1 Antibody (NBP1-58959).

Pathways for RACK1/GNB2L1 Antibody (NBP1-58959)

View related products by pathway.

PTMs for RACK1/GNB2L1 Antibody (NBP1-58959)

Learn more about PTMs related to RACK1/GNB2L1 Antibody (NBP1-58959).

Research Areas for RACK1/GNB2L1 Antibody (NBP1-58959)

Find related products by research area.

Blogs on RACK1/GNB2L1

There are no specific blogs for RACK1/GNB2L1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our RACK1/GNB2L1 Antibody and receive a gift card or discount.


Gene Symbol GNB2L1