RACK1/GNB2L1 Antibody - BSA Free

Western Blot: GNB2L1 Antibody [NBP1-58959] - Transfected 293T, Antibody Titration: 0.2-1 ug/ml

Immunohistochemistry-Paraffin: GNB2L1 Antibody [NBP1-58959] - Human small intestine tissue at an antibody concentration of 5ug/ml.

• Reactivity: Hu, In
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

RACK1/GNB2L1 Antibody - BSA Free Summary

• Description: The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
• Immunogen: Synthetic peptides corresponding to GNB2L1(guanine nucleotide binding protein (G protein), beta polypeptide 2-like 1) The peptide sequence was selected from the N terminal of GNB2L1 (NP_006089). Peptide sequence ISSDGQFALSGSWDGTLRLWDLTTGTTTRRFVGHTKDVLSVAFSSDNRQI The peptide sequence for this immunogen was taken from within the described region.
• Specificity: This product is specific to Subunit or Isoform: beta-2-like 1.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: RACK1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 5 ug/ml
  • Western Blot 1.0 ug/ml
• Theoretical MW: 35 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Reactivity Notes

Invertebrate reactivity reported in scientific literature (PMID: 24374472).

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for RACK1/GNB2L1 Antibody - BSA Free

• GNB2L1
• guanine nucleotide binding protein (G protein), beta polypeptide 2-like 1
• guanine nucleotide binding
• RACK1
• Receptor for Activated C Kinase 1
• Receptor for activated C kinase

Background

GNB2L1 seems to bind protein kinase C acting as an intracellular receptor to anchor the activated PKC to the cytoskeleton. GNB2L1 may be involved in up-regulation of the activity of kinases such as PKC via binding to KRT1. Together with KRT1 and ITGB1, GNB2L1 serves as a platform for SRC activation or inactivation. GNB2L1 may play an important role in the developing brain and neuronal differentiation.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for RACK1/GNB2L1 Antibody (NBP1-58959)(1)

Publication using NBP1-58959

• Yang B, Pu F, Qin J et al. Characterization of receptor of activated C kinase 1 (RACK1) and functional analysis during larval metamorphosis of the oyster Crassostrea angulata. Gene 2013-12-27 [PMID: 24374472] (WB, Invertebrate)

Bioinformatics

• Gene Symbol: RACK1
• Uniprot:
  • P63244()