![Western Blot: RABGAP1L Antibody [NBP2-85581] - Host: Rabbit. Target Name: RABGAP1L. Sample Type: HT1080 Whole Cell lysates. Antibody Dilution: 1.0ug/ml](http://images.novusbio.com/fullsize2/RABGAP1L Antibody-Western Blot-NBP2-85581-img0001.jpg "Western Blot: RABGAP1L Antibody [NBP2-85581] - Host: Rabbit. Target Name: RABGAP1L. Sample Type: HT1080 Whole Cell lysates. Antibody Dilution: 1.0ug/ml")
| Reactivity | Hu, Mu, Rt, Po, Eq, RbSpecies Glossary |
| Applications | WB |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human RABGAP1L. Peptide sequence: EVVSLQRESDKEEPVTPTSGGGPMSPQDDEAEEESDNELSSGTGDVSKDC The peptide sequence for this immunogen was taken from within the described region. |
| Predicted Species | Mouse (93%), Rat (100%), Porcine (93%), Rabbit (100%), Equine (93%). Backed by our 100% Guarantee. |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | RABGAP1L |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS, 2% Sucrose |
| Preservative | 0.09% Sodium Azide |
| Purity | Immunogen affinity purified |
![ACE/CD143 Antibody [Unconjugated]](/sites/all/modules/enterprise-tech/et_datasheets/images/novus_guarantee.png "ACE/CD143 Antibody [Unconjugated]")
Secondary Antibodies |
Isotype Controls |
Diseases for RABGAP1L Antibody (NBP2-85581)Discover more about diseases related to RABGAP1L Antibody (NBP2-85581).
| Pathways for RABGAP1L Antibody (NBP2-85581)View related products by pathway.
|
PTMs for RABGAP1L Antibody (NBP2-85581)Learn more about PTMs related to RABGAP1L Antibody (NBP2-85581).
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | RABGAP1L |
![Western Blot: Angiotensin II/III Antibody (Ang II E7 (BGN/KA/4L)) [NB100-62346] - Protein expressions of intrarenal RAS components in two groups of mice. Western blot analysis for protein expressions of intrarenal RAS components in the two groups of mice. Image collected and cropped by CiteAb from the following publication (lipidworld.biomedcentral.com/articles/10.1186/1476-511X-12-49), licensed under a CC-BY licence.](http://images.novusbio.com/images2/Angiotensin-II-III-Antibody-(Ang-II-E7-(BGN-KA-4L))-Western-Blot-NB100-62346-img0002.jpg)
![Immunohistochemistry: Angiotensin II/III Antibody (Ang II E7 (BGN/KA/4L)) [NB100-62346] - Protein expressions of intrarenal RAS components in two groups of mice. (A) Immunohistochemical analysis of intrarenal RAS expression position in the two groups of mice. AGT immunoreactivity in the proximal tubular cells, Ang II immunoreactivity in both glomerular and tubular cells, renin immunoreactivity in juxtaglomerular apparatus cells, ACE immunoreactivity in brush border membranes of proximal tubules as well as AT1 and AT2 immunoreactivity in the proximal tubules were increased in the HF group when compared to the control group. Image collected and cropped by CiteAb from the following publication (lipidworld.biomedcentral.com/articles/10.1186/1476-511X-12-49), licensed under a CC-BY licence.](http://images.novusbio.com/images2/Angiotensin-II-III-Antibody-(Ang-II-E7-(BGN-KA-4L))-Immunohistochemistry-NB100-62346-img0003.jpg)
![Western Blot: Angiotensin II/III Antibody (Ang II E7 (BGN/KA/4L)) [NB100-62346] - Evaluation of angiotensis II expression in untreated UUO rat kidneys and UUO rat kidneys treated with Ang-(1-7).](http://images.novusbio.com/images2/Angiotensin-II-III-Antibody-(Ang-II-E7-(BGN-KA-4L))-Western-Blot-NB100-62346-img0001.jpg)
![Western Blot: HES-1 Antibody (OTI4H1) [NBP1-47791] - HEK293T cells were transfected with the pCMV6-ENTRY control (Left lane) or pCMV6-ENTRY HES1 (Right lane) cDNA for 48 hrs and lysed. Equivalent amounts of cell lysates (5 ug per lane) were separated by SDS-PAGE and immunoblotted with anti-HES1 (1:500).](http://images.novusbio.com/images2/HES-1-Antibody-(OTI4H1)-Western-Blot-NBP1-47791-img0018.jpg)
![Immunocytochemistry/Immunofluorescence: HES-1 Antibody (OTI4H1) [NBP1-47791] - HeLa cells using anti-HES1 mouse monoclonal antibody.](http://images.novusbio.com/images2/HES-1-Antibody-(OTI4H1)-Immunocytochemistry-Immunofluorescence-NBP1-47791-img0010.jpg)
![Immunohistochemistry-Paraffin: HES-1 Antibody (OTI4H1) [NBP1-47791] - Staining of paraffin-embedded liver using anti-Hes1 mouse monoclonal antibody.](http://images.novusbio.com/images2/HES-1-Antibody-(OTI4H1)-Immunohistochemistry-Paraffin-NBP1-47791-img0015.jpg)
![Western Blot: Connexin 26/GJB2 Antibody [NBP2-41304] - Western blotting analysis detects Cx26 using R(alpha)Cx26-Ct or R(alpha)Cx26-cl antibodies. (a) R(alpha)Cx26-Ct (A) and R(alpha)Cx26-cl (B) antibodies detected a specific 26kDa band on pig heart tissue lysates (lanes A and B are cropped blots obtained from the same gel). R(alpha)Cx26-cl recognized the 26kDa band on human and rat heart (H) lysates and on rat liver (L) sample (positive control) although two unspecific bands at molecular weights lower than 26kDa were detected. No bands were detected on smooth muscle (SM) tissue lysates (negative control) by R(alpha)Cx26-cl. R(alpha)GAPDH was used as protein loading control for rat tissue samples run on the same gel. Image collected and cropped by CiteAb from the following publication (nature.com/articles/s41598-018-32405-2), licensed under a CC-BY licence.](http://images.novusbio.com/images2/Connexin-26-GJB2-Antibody-Western-Blot-NBP2-41304-img0005.jpg)
![Immunocytochemistry/Immunofluorescence: Connexin 26/GJB2 Antibody [NBP2-41304] - Cx26 distribution at level of the cardiomyocyte cytoplasm. Confocal laser scanning microscopy: representative images of rat and pig heart sections. Double immunofluorescence analysis for Cx26 (red) and Cx43 (green) show a distinct cell localization of the two Cxs. (a) Three dimensional picture of the maximum intensity projection of the raw images of longitudinal rat heart section treated with R(alpha)Cx26-cl and M(alpha)Cx43. Scale bar: 20um. Image collected and cropped by CiteAb from the following publication (nature.com/articles/s41598-018-32405-2), licensed under a CC-BY licence.](http://images.novusbio.com/images2/Connexin-26-GJB2-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-41304-img0002.jpg)
![Immunohistochemistry: Connexin 26/GJB2 Antibody [NBP2-41304] - Human and rat cardiomyocytes immunoreact with R(alpha)Cx26 antibodies. Representative images of immunohistochemical analysis for Cx26 by R(alpha)Cx26-Ct or R(alpha)Cx26-cl antibodies. Longitudinal (c and d) sections showing positivity in cardiomyocytes and in smooth muscle cells of vessel (arrow); Rat (d) immunoperoxidase shows brown immunoreaction in the cell cytoplasm of working cardiomyocytes and in smooth muscle cells of vessels (arrows); positivity of cardiomyocytes and smooth muscle cells has shown, at higher magnification, in longitudinal (d) and cross sections (c); Negative controls are shown in the squares. Scale bars: 50um. Image collected and cropped by CiteAb from the following publication (nature.com/articles/s41598-018-32405-2), licensed under a CC-BY licence.](http://images.novusbio.com/images2/Connexin-26-GJB2-Antibody-Immunohistochemistry-NBP2-41304-img0004.jpg)
![Western Blot: HMGCL Antibody [NBP1-32767] - rat liver lysate/extract 10 % SDS-PAGE gel, antibody dilution 1:10000.](http://images.novusbio.com/images2/HMGCL Antibody-Western Blot-NBP1-32767-img0007.jpg)
![Immunocytochemistry/Immunofluorescence: HMGCL Antibody [NBP1-32767] - HeLa cells were fixed in ice-cold MeOH for 5 min. Green: HMGCL protein stained by HMGCL antibody diluted at 1:500. Blue: Hoechst 33342 staining. Scale bar = 10 um.](http://images.novusbio.com/images2/HMGCL-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-32767-img0008.jpg)
![Immunohistochemistry-Paraffin: HMGCL Antibody [NBP1-32767] - Paraffin-embedded SW480 xenograft, using antibody at 1:500 dilution.](http://images.novusbio.com/images2/HMGCL Antibody-Immunohistochemistry-Paraffin-NBP1-32767-img0005.jpg)
![Immunocytochemistry/Immunofluorescence: LIPC Antibody [NBP3-04922] - Analysis of A549 cells using LIPC antibody. Blue: DAPI for nuclear staining.](http://images.novusbio.com/images2/LIPC Antibody-Immunocytochemistry-Immunofluorescence-NBP3-04922-img0001.jpg)
![Western Blot: HFE Antibody (1G12) [H00003077-M01] - Analysis of HFE expression in transfected 293T cell line by HFE monoclonal antibody (M01), clone 1G12.Lane 1: HFE transfected lysate(40.1 KDa).Lane 2: Non-transfected lysate.](http://images.novusbio.com/images2/HFE-Antibody-(1G12)-Western-Blot-H00003077-M01-img0009.jpg)
![Immunocytochemistry/Immunofluorescence: HFE Antibody (1G12) [H00003077-M01] - Analysis of monoclonal antibody to HFE on HeLa cell. Antibody concentration 10 ug/ml.](http://images.novusbio.com/images2/HFE-Antibody-(1G12)-Immunocytochemistry-Immunofluorescence-H00003077-M01-img0006.jpg)
![Western Blot: HFE Antibody (1G12) [H00003077-M01] - HFE monoclonal antibody (M01), clone 1G12. Analysis of HFE expression in A-431.](http://images.novusbio.com/images2/HFE-Antibody-(1G12)-Western-Blot-H00003077-M01-img0008.jpg)
![Western Blot: Presenilin-1 Antibody (APS 18) [NB100-74510] - Analysis of THP-1 cell lysate.](http://images.novusbio.com/images2/Presenilin-1-Antibody-(APS-18)-Western-Blot-NB100-74510-img0013.jpg)
![Immunocytochemistry/Immunofluorescence: Presenilin-1 Antibody (APS 18) [NB100-74510] - Analysis of Presenilin 1 using Presenilin 1 Monoclonal antibody (APS 18) shows staining in A2058 melanoma cells. Presenilin 1 staining (green), F-Actin staining with Phalloidin (red) and nuclei with DAPI (blue) is shown. Cells were grown on chamber slides and fixed with formaldehyde prior to staining. Cells were probed without (control) or with or an antibody recognizing Presenilin 1 at a dilution of 1:20-1:100 over night at 4C, washed with PBS and incubated with a DyLight-488 conjugated.](http://images.novusbio.com/images2/Presenilin-1-Antibody-(APS-18)-Immunocytochemistry-Immunofluorescence-NB100-74510-img0022.jpg)
![Immunohistochemistry-Paraffin: Presenilin-1 Antibody (APS 18) [NB100-74510] - Normal biopsies of deparaffinized Human liver tissue.](http://images.novusbio.com/images2/Presenilin-1-Antibody-(APS-18)-Immunohistochemistry-Paraffin-NB100-74510-img0024.jpg)
![Immunohistochemistry-Paraffin: RUNX1/CBFA2 Antibody [NBP1-89105] - Staining in human breast and liver tissues using NBP1-89105 antibody. Corresponding RUNX1 RNA-seq data are presented for the same tissues.](http://images.novusbio.com/images2/RUNX1-CBFA2-Antibody-Immunohistochemistry-Paraffin-NBP1-89105-img0017.jpg)
![Immunocytochemistry/Immunofluorescence: RUNX1/CBFA2 Antibody [NBP1-89105] - Staining human cell line A-431 shows localization to nucleoplasm & vesicles. Antibody staining is shown in green.](http://images.novusbio.com/images2/RUNX1-CBFA2-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-89105-img0008.jpg)
![Immunohistochemistry-Paraffin: RUNX1/CBFA2 Antibody [NBP1-89105] - Staining of human breast shows moderate to strong nuclear positivity in glandular cells.](http://images.novusbio.com/images2/RUNX1-CBFA2-Antibody-Immunohistochemistry-Paraffin-NBP1-89105-img0013.jpg)
![Western Blot: EPB41L3 Antibody [NB110-61027] - Detection of Band 4.1-like protein 3 in mouse brain lysate](http://images.novusbio.com/images2/EPB41L3-Antibody-Western-Blot-NB110-61027-img0002.jpg)
![Western Blot: EPB41L3 Antibody [NB110-61027] - Detection of Band 4.1-like protein 3 in HeLa whole cell lysate](http://images.novusbio.com/images2/EPB41L3-Antibody-Western-Blot-NB110-61027-img0003.jpg)
![Simple Western: EPB41L3 Antibody [NB110-61027] - Simple Western lane view shows a specific band for EPB41L3 in 0.5 mg/ml of HeLa lysate. This experiment was performed under reducing conditions using the 12-230 kDa separation system.](http://images.novusbio.com/images2/EPB41L3-Antibody-Simple-Western-NB110-61027-img0004.jpg)
![Western Blot: SLC25A15 Antibody [NBP2-20387] - Sample (30 ug of whole cell lysate) A: Raji 12% SDS PAGE GTX109432 diluted at 1:1000.](http://images.novusbio.com/images2/SLC25A15-Antibody-Western-Blot-NBP2-20387-img0004.jpg)
![Immunohistochemistry-Paraffin: SLC25A15 Antibody [NBP2-20387] - Mouse heart. ORNT1 antibody [N1C3-2] diluted at 1:500. Antigen Retrieval: Citrate buffer, pH 6.0, 15 min.](http://images.novusbio.com/images2/SLC25A15-Antibody-Immunohistochemistry-Paraffin-NBP2-20387-img0005.jpg)
![Western Blot: Kininogen Antibody [NBP1-89993] - Analysis in control (vector only transfected HEK293T lysate) and Kininogen over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).](http://images.novusbio.com/images2/LMW-Kininogen-Antibody-Western-Blot-NBP1-89993-img0009.jpg)
![Immunohistochemistry-Paraffin: Kininogen Antibody [NBP1-89993] - Staining of human kidney using Kininogen antibody NBP1-89993.](http://images.novusbio.com/images2/LMW Kininogen Antibody-Immunohistochemistry-Paraffin-NBP1-89993-img0014.jpg)
![Western Blot: Kininogen Antibody [NBP1-89993] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative control (vector only transfected HEK293T lysate). Lane 3: Over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).](http://images.novusbio.com/images2/LMW-Kininogen-Antibody-Western-Blot-NBP1-89993-img0003.jpg)
![Western Blot: CXCL4L1 Antibody [NBP1-70510] - PANC1 cell lysate, concentration 0.2-1 ug/ml.](http://images.novusbio.com/images2/CXCL4L1 Antibody-Western Blot-NBP1-70510-img0002.jpg)
![Western Blot: TC21/R-Ras2 Antibody (2D3-4B8) [H00022800-M01] - Identification of defatty-acylation targets of SIRT6 that contribute to its function in cell proliferation. Effects of R-Ras2 knockdown on the proliferation of Sirt6 WT and KO MEFs. Values with error bars indicate mean +- s.d. of three biological replicates. *** indicates p<0.005 for comparing to Sirt6 KO MEFs. Schematic overview of the SILAC experiment to compare the protein abundance in Sirt6 WT and KO. Image collected and cropped by CiteAb from the following publication (https://elifesciences.org/articles/25158) licensed under a CC-BY licence.](http://images.novusbio.com/images2/TC21-R-Ras2 Antibody (2D3-4B8)-Western Blot-H00022800-M01-img0021.jpg)
![Immunocytochemistry/Immunofluorescence: TC21/R-Ras2 Antibody (2D3-4B8) [H00022800-M01] - Analysis of monoclonal antibody to RRAS2 on A-431 cell. Antibody concentration 10 ug/ml.](http://images.novusbio.com/images2/TC21-R-Ras2-Antibody-(2D3-4B8)-Immunocytochemistry-Immunofluorescence-H00022800-M01-img0010.jpg)
![Immunohistochemistry-Paraffin: TC21/R-Ras2 Antibody (2D3-4B8) [H00022800-M01] - Analysis of monoclonal antibody to RRAS2 on formalin-fixed paraffin-embedded human dysgerminoma tissue. Antibody concentration 5 ug/ml.](http://images.novusbio.com/images2/TC21-R-Ras2-Antibody-(2D3-4B8)-Immunohistochemistry-Paraffin-H00022800-M01-img0012.jpg)