RAB8B Antibody (1E4)

Images

 
Sandwich ELISA: RAB8B Antibody (1E4) [H00051762-M01] - Detection limit for recombinant GST tagged RAB8B is 0.03 ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, S-ELISA
Clone
1E4
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

RAB8B Antibody (1E4) Summary

Immunogen
RAB8B (NP_057614.1, 101 a.a. ~ 207 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. NWIRNIEEHASSDVERMILGNKCDMNDKRQVSKERGEKLAIDYGIKFLETSAKSSANVEEAFFTLARDIMTKLNRKMNDSNSAGAGGPVKITENRSKKTSFFRCSLL
Specificity
RAB8B - RAB8B, member RAS oncogene family (1E4)
Isotype
IgG2b Kappa
Clonality
Monoclonal
Host
Mouse
Gene
RAB8B
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
  • Sandwich ELISA
  • Western Blot 1:500
Application Notes
Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for RAB8B Antibody (1E4)

  • FLJ38125
  • RAB-8b protein
  • RAB8B, member RAS oncogene family
  • ras-related protein Rab-8B

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00004218-M02
Species: Hu, Mu, Ze
Applications: ELISA, ICC/IF, IHC, WB
NBP2-45499
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
NBP2-45883
Species: Hu
Applications: IHC, WB
NBP2-94887
Species: Hu, Mu
Applications: ICC/IF, WB
NBP1-51634
Species: Hu, Mu
Applications: ELISA, ICC/IF, WB
NBP1-46574
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
H00005873-M02
Species: Hu, Mu, Rb
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, IP, KD, S-ELISA, WB
NB100-74510
Species: Hu, Mu, Pm, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, WB
H00008878-M01
Species: Bv, Ha, Hu, Mu, Rb, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
NBP3-13395
Species: Mu, Rt
Applications: WB
NBP2-34294
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P
NBP1-46535
Species: Hu, Mu, Rb, Rt, Xp, Ze
Applications: ICC/IF, IHC-FrFl, IHC, IHC-Fr, IHC-P, WB
NB600-302
Species: Bv, Dr, Hu, Mu
Applications: ChIP, ELISA, Flow-IC, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, PLA, S-ELISA, Simple Western, WB
NBP2-31896
Species: Hu
Applications: IHC, IHC-Fr, IHC-P, WB
NBP2-13075
Species: Ba, Hu, Pm, Mu, Rt
Applications: DB, ELISA, IB, ICC/IF, IHC-FrFl, IHC, IHC-Fr, IHC-P, IP, WB
NBP1-87940
Species: Hu
Applications: IHC, IHC-P
NBP1-87185
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
H00051762-M01
Species: Hu
Applications: WB, ELISA, S-ELISA

Publications for RAB8B Antibody (H00051762-M01) (0)

There are no publications for RAB8B Antibody (H00051762-M01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RAB8B Antibody (H00051762-M01) (0)

There are no reviews for RAB8B Antibody (H00051762-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for RAB8B Antibody (H00051762-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional RAB8B Products

Bioinformatics Tool for RAB8B Antibody (H00051762-M01)

Discover related pathways, diseases and genes to RAB8B Antibody (H00051762-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RAB8B Antibody (H00051762-M01)

Discover more about diseases related to RAB8B Antibody (H00051762-M01).
 

Pathways for RAB8B Antibody (H00051762-M01)

View related products by pathway.

PTMs for RAB8B Antibody (H00051762-M01)

Learn more about PTMs related to RAB8B Antibody (H00051762-M01).
 

Research Areas for RAB8B Antibody (H00051762-M01)

Find related products by research area.

Blogs on RAB8B

There are no specific blogs for RAB8B, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our RAB8B Antibody (1E4) and receive a gift card or discount.

Bioinformatics

Gene Symbol RAB8B
Entrez
Uniprot