Home » RAB7B » RAB7B Antibodies » RAB7B Antibody (1C3)

RAB7B Antibody (1C3)

 Submit a Review

Images

 
(
Enlarge)
Western Blot: RAB7B Antibody (1C3) [H00338382-M02] - Analysis of RAB7B expression in transfected 293T cell line by RAB7B monoclonal antibody (M02), clone 1C3.Lane 1: RAB7B transfected lysate(22.5 KDa).Lane 2: Non-transfected lysate.
Western Blot: RAB7B Antibody (1C3) [H00338382-M02] - Analysis of RAB7B expression in transfected 293T cell line by RAB7B monoclonal antibody (M02), clone 1C3.Lane 1: RAB7B transfected lysate(22.5 KDa).Lane 2: ...read more
Sandwich ELISA: RAB7B Antibody (1C3) [H00338382-M02] - Detection limit for recombinant GST tagged RAB7B is 0.1 ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, S-ELISA
Clone
1C3
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

100% Guarantee on every product

RAB7B Antibody (1C3) Summary

Immunogen
RAB7B (NP_796377, 100 a.a. ~ 199 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. DIWRGDVLAKIVPMEQSYPMVLLGNKIDLADRKVPQEVAQGWCREKDIPYFEVSAKNDINVVQAFEMLASRALSRYQSILENHLTESIKLSPDQSRSRCC
Marker
Late Endosome Marker
Specificity
RAB7B - RAB7B, member RAS oncogene family (1C3)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
RAB7B
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • ELISA
  • Sandwich ELISA
  • Western Blot 1:500
Application Notes
Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for RAB7B Antibody (1C3)

  • MGC16212
  • MGC9726
  • RAB7
  • RAB7B, member RAS oncogene family
  • Ras-related protein Rab-7
  • ras-related protein Rab-7b

Background

Members of the RAB family of RAS related GTP binding proteins are important regulators of vesicular transport and are located in specific intracellular compartments. RAB7 has been localized to late endosomes and shown to be important in the late endocytic pathway. In addition, it has been shown to have a fundamental role in the cellular vacuolation induced by the cytotoxin VacA of Helicobacter pylori.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Rab5a Antibody
NB120-13253
Western Blot: Rab5a Antibody [NB120-13253] - Western blot analysis of Human Cell line lysates showing detection of Rab5aprotein using Rabbit Anti-Rab5aPolyclonal Antibody (NB120-13253). Load: 15 ugprotein. Block: 1.5% BSA for 30 minutes at RT. Primary Antibody: Rabbit Anti-Rab5aPolyclonal Antibody (NB120-13253) at 1:1000 for 2 hours at RT. Secondary Antibody: Donkey Anti-Rabbit IgG: HRP for 1 hour at RT.
Immunohistochemistry: Rab5a Antibody [NB120-13253] - Immunohistochemistry analysis using Rabbit Anti-Rab5aPolyclonal Antibody (NB120-13253). Tissue: backskin. Species: Mouse. Fixation: Bouin's Fixative Solution. Primary Antibody: Rabbit Anti-Rab5aPolyclonal Antibody (NB120-13253) at 1:100 for 1 hour at RT. Secondary Antibody: FITC Goat Anti-Rabbit (green) at 1:50 for 1 hour at RT. Localization: Cytoplasm.
Immunohistochemistry-Paraffin: Rab5a Antibody [NB120-13253] - analysis using Rabbit Anti-Rab5 Polyclonal Antibody . Tissue: backskin. Species: Mouse. Fixation: Bouins Fixative Solution. Primary Antibody: Rabbit Anti-Rab5 Polyclonal Antibody at 1:100 for 1 hour at RT. Secondary Antibody: FITC Goat Anti-Rabbit (green) at 1:50 for 1 hour at RT. Localization: Cytoplasm.
(2 Reviews)
(14 Publications)
Species: Bv, Hu, Pm, Mu, Rt
Applications: ICC/IF, IHC-FrFl, IHC, IHC-P, IP, WB
HIV-1 Rev binding
protein Antibody
NBP1-91991
Immunocytochemistry/Immunofluorescence: HIV-1 Rev binding protein Antibody [NBP1-91991] - Immunofluorescent staining of human cell line A-431 shows localization to vesicles.
Western Blot: HIV-1 Rev binding protein Antibody [NBP1-91991] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).
Immunohistochemistry-Paraffin: HIV-1 Rev binding protein Antibody [NBP1-91991] - Staining of human placenta shows strong membranous positivity in trophoblastic cells.
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
LAMP-1/CD107a
Antibody (5E7) - BSA
NBP2-52721
Immunocytochemistry/Immunofluorescence: LAMP-1/CD107a Antibody (5E7) [NBP2-52721] - MCF-7 human breast cancer cell line. Secondary antibody goat anti-mouse IgG Fc Dy680 (NBP1-72880). Image from verified customer review.
Immunocytochemistry/Immunofluorescence: LAMP-1/CD107a Antibody (5E7) [NBP2-52721] - ICC usage of NBP2-52721. Image submittied via verified customer review.
Immunocytochemistry/Immunofluorescence: LAMP-1/CD107a Antibody (5E7) [NBP2-52721] - A431 cells were fixed for 10 minutes using 10% formalin and then permeabilized for 5 minutes using 1X TBS + 0.5% Triton-X100. The cells were incubated with anti-LAMP (5E7) at a 1:200 dilution overnight at 4C and detected with an anti-mouse Dylight 488 (Green) at a 1:500 dilution. Actin was detected with Phalloidin 568 (Red) at a 1:200 dilution. Nuclei were counterstained with DAPI (Blue). Cells were imaged using a 40X objective.
(2 Reviews)
(4 Publications)
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Rab11A Antibody
NBP2-49320
Western Blot: Rab11A Antibody [NBP2-49320] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10Lane 2: Human cell line RT-4Lane 3: Human cell line U-251 MGLane 4: Human plasmaLane 5: Human Liver tissueLane 6: Human Tonsil tissue
Immunohistochemistry-Paraffin: Rab11A Antibody [NBP2-49320] - Staining of human colon shows moderate positivity in glandular cells.
Immunohistochemistry-Paraffin: Rab11A Antibody [NBP2-49320] - Staining of human testis shows weak to moderate cytoplasmic positivity in cells in seminiferous ducts.
(2 Reviews)
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
PRICKLE1 Antibody
NBP1-83967
Immunohistochemistry-Paraffin: PRICKLE1 Antibody [NBP1-83967] - Staining of human fallopian tube shows weak to moderate nuclear positivity in glanular cells.
Immunohistochemistry-Paraffin: PRICKLE1 Antibody [NBP1-83967] - Staining of human testis shows moderate nuclear postivity in cells in seminiferous ducts.
Immunohistochemistry-Paraffin: PRICKLE1 Antibody [NBP1-83967] - Staining of human cerebral cortex shows moderate strong nuclear positivity in neurons.
(1 Review)
Species: Hu
Applications: ICC/IF, IHC, IHC-P
EGFR Antibody
[Unconjugated]
AF231
EGFR was detected in immersion fixed frozen sections of human skin using Goat Anti-Human EGFR Antigen Affinity-purified Polyclonal Antibody (Catalog # AF231) at 1 µg/mL for 1 hour at room temperature followed by incubation with the Anti-Goat IgG VisUCyte™ HRP Polymer Antibody (Catalog # VC004). Tissue was stained using DAB (brown) and counterstained with hematoxylin (blue). Specific staining was localized to plasma membrane. View our protocol for IHC Staining with VisUCyte HRP Polymer Detection Reagents.
EGFR was detected in immersion fixed A431 human epithelial carcinoma cell line using Goat Anti-Human EGFR Antigen Affinity-purified Polyclonal Antibody (Catalog # AF231) at 1 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Goat IgG Secondary Antibody (red; Catalog # NL001) and counterstained with DAPI (blue). Specific staining was localized to plasma membrane. View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
Western blot shows lysates of HeLa human cervical epithelial carcinoma cell line and MDA‑MB‑231 human breast cancer cell line. PVDF membrane was probed with 1 µg/mL of Goat Anti-Human EGFR Antigen Affinity-purified Polyclonal Antibody (Catalog # AF231) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF017). A specific band was detected for EGFR at approximately 175 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
(15 Publications)
Species: Hu
Applications: CyTOF-ready, ELISA(Cap), ELISA(Det), ELISA(Sta), Flow, ICC, IHC, IP, Simple Western, WB
EEA1 Antibody
(6D4.1D4) - BSA Free
NBP2-36568
Flow (Intracellular): EEA1 Antibody (6D4.1D4) [NBP2-36568] - Intracellular staining of human EEA1 in Flow cytometry using 2.5 ug of antibody per 1 million cells. Isotype control was mouse IgG1.
Immunohistochemistry-Paraffin: EEA1 Antibody (6D4.1D4) [NBP2-36568] - Analysis of FFPE tissue section of mouse testes using mouse monoclonal EEA1 antibody (clone 6D4.1D4) at 10 ug/ml concentration. The interstitial cells depicted a punctate to granular cytoplasmic staining pattern for EEA1 protein with no signal in other cell types.
Immunohistochemistry-Paraffin: EEA1 Antibody (6D4.1D4) [NBP2-36568] - Analysis of FFPE tissue section of human testes using mouse monoclonal EEA1 antibody (clone 6D4.1D4) at 10 ug/ml concentration. The interstitial cells depicted a punctate to granular cytoplasmic staining pattern for EEA1 protein.
(2 Publications)
Species: Hu, Mu
Applications: Flow-IC, ICC/IF, IHC, IHC-P, WB
RAB9A Antibody
NBP1-87172
Western Blot: RAB9A Antibody [NBP1-87172] - Lane 1: Marker [kDa] 230, 110, 82, 49, 32, 26, 18. Lane 2: Human cell line RT-4
Immunohistochemistry-Paraffin: RAB9A Antibody [NBP1-87172] - Staining of human adrenal gland shows high expression.
Immunohistochemistry-Paraffin: RAB9A Antibody [NBP1-87172] - Staining of human skeletal muscle shows low expression as expected.
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Rab4 Antibody
(4E11) - BSA Free
NBP2-37485
ELISA: Rab4 Antibody (4E11) [NBP2-37485] - Red: Control Antigen (100ng); Purple: Antigen (10ng); Green: Antigen (50ng); Blue: Antigen (100ng);
Western Blot: Rab4 Antibody (4E11) [NBP2-37485] - Analysis using RAB4A mAb against human RAB4A (AA: 22-218) recombinant protein. (Expected MW is 47.9 kDa)
Western Blot: Rab4 Antibody (4E11) [NBP2-37485] - Analysis using RAB4A mouse mAb against Jurkat (1), HeLa (2), A549 (3), HEK293 (4), K562 (5), NIH3T3 (6), PC-12 (7), and COS7 (8) cell lysate.
Species: Hu, Pm, Mu, Pm
Applications: CyTOF-ready, ELISA, Flow, IHC, IHC-P, WB
Cathepsin D
Antibody [Unconjugate
AF1029
Cathepsin D was detected in perfusion fixed frozen sections of mouse intestine using 15 µg/mL Goat Anti-Mouse Cathepsin D Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1029) overnight at 4 °C. Tissue was stained with the Anti-Goat HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS008) and counter­stained with hematoxylin (blue). Specific labeling was localized to epithelial cells in intestinal villi. View our protocol for Chromogenic IHC Staining of Frozen Tissue Sections.
Cathepsin D was detected in immersion fixed RAW 264.7 mouse monocyte/macrophage cell line using Goat Anti-Mouse Cathepsin D Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1029) at 5 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Goat IgG Secondary Antibody (red; Catalog # NL001) and counterstained with DAPI (blue). Specific staining was localized to lysosomes. View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
Western blot shows lysate of mouse intestine tissue. PVDF membrane was probed with 1 µg/mL of Goat Anti-Mouse Cathepsin D Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1029) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF017). Specific bands were detected for Cathepsin D at approximately 28 and 45 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
(26 Publications)
Species: Mu
Applications: ICC, IHC, IP, WB
EGF [Unconjugated]
236-EG
1 µg/lane of Recombinant Human EGF was resolved with SDS-PAGE  and visualized by silver staining under reducing (R) conditions, showing a single band at 6 kDa.
Recombinant Human EGF (Catalog # 236‑EG) stimulates cell proliferation of the Balb/3T3 mouse embryonic fibroblast cell line. The ED50 for this effect is 20‑100 pg/mL.
(670 Publications)
Species: Hu
Applications: BA
RAB6A Antibody
NBP1-33110
Immunocytochemistry/Immunofluorescence: RAB6A Antibody [NBP1-33110] - A549 cells were fixed in 4% paraformaldehyde at RT for 15 min. Green: RAB6A protein stained by RAB6A antibody diluted at 1:500. Blue: Hoechst 33342 staining. Scale bar = 10 um.
Western Blot: RAB6A Antibody [NBP1-33110] - A. 30 ug A549 whole cell lysate/extract B. 30 ug H1299 whole cell lysate/extract C. 30 ug HCT116 whole cell lysate/extract 12 % SDS-PAGE RAB6A antibody dilution: 1:1000
Knockout Validated: RAB6A Antibody [NBP1-33110] - Wild-type (WT) and RAB6A knockout (KO) 293T cell extracts (30 ug) were separated by 12% SDS-PAGE, and the membrane was blotted with RAB6A antibody diluted at 1:500. HRP-conjugated anti-rabbit IgG antibody was used to detect the primary antibody.
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KO, WB
LAMP-2/CD107b
Antibody (H4B4) - BSA ...
NBP2-22217
ELISA: LAMP-2/CD107b Antibody (H4B4) [NBP2-22217] - Anti-LAMP-2/CD107b was used to assess lysates from human SVG-A cells via ELISA, by loading the indicated mass of total protein per well. Antibodies tested were diluted 1:250, and used in conjunction with an HRP-conjugated secondary antibody. Signal was detected by luminescence. Image from verified customer review.
Immunocytochemistry/Immunofluorescence: LAMP-2/CD107b Antibody (H4B4) [NBP2-22217] - Immunofluorescence: [Alexa Fluor® 647] [NBP2-22217AF647] - T98G glioblastoma cells grown on #1.5 coverglass stained with a conjugated LAMP-2/CD107b (H4B4)AF647 antibody, counterstained with DAPI. Cathepsin D (green) staining also visible. This image was submitted via customer Review. Image using the Alexa Fluor 647 form of this antibody.
Knockout Validated: LAMP-2/CD107b Antibody (H4B4) [NBP2-22217] - Lysates of HeLa human cervical epithelial carcinoma parental cell line and LAMP2 knockout (KO) HeLa cell line. PVDF membrane was probed with Mouse Anti-Human LAMP-2/CD107b (H4B4) Monoclonal Antibody (Catalog # NBP2-22217) followed by HRP-conjugated Anti-Rabbit IgG Secondary Antibody (Catalog #HAF008). Specific band was detected for LAMP-2/CD107b at approximately 100 kDa (as indicated) in the parental HeLa cell line, but is not detectable in the knockout HeLa cell line. This experiment was conducted under reducing conditions.
(2 Reviews)
(26 Publications)
Species: Ch, Hu, Mu, Rt(-)
Applications: CyTOF-ready, ELISA, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, KO, Simple Western, WB
NOD2 Antibody
(2D9) - BSA Free
NB100-524
Flow Cytometry: NOD2 Antibody (2D9) [NB100-524] - An intracellular stain was performed on Jurkat cells with NOD2 (2D9) antibody NB100-524APC (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 2.5 ug/mL for 30 minutes.
Flow Cytometry: NOD2 Antibody (2D9) [NB100-524] - An intracellular stain was performed on Jurkat cells with NOD2 (2D9) antibody NB100-524PE (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 2.5 ug/mL for 30 minutes.Both antibodies were conjugated to phycoerythrin.
Immunohistochemistry-Frozen: NOD2 Antibody (2D9) [NB100-524] - Overlay of NOD2-DyLight 488 (green) with phase contrast of murine colon. Image from verified customer review.
(1 Review)
(24 Publications)
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
CTLA-4
[Unconjugated]
7268-CT
Recombinant Human CTLA-4 Fc Chimera (Catalog # 7268-CT) inhibits IL-2 secretion by stimulated Jurkat human acute Tcell leukemia cells. The ED50 for this effect is 0.03-0.15 μg/mL whenstimulated with 1 μg/mL Recombinant Human B7‑1/CD80 Fc Chimera (Catalog # 140-B1).
(3 Publications)
Species: Hu
Applications: BA
Holo-Transferrin
2914-HT
Holo-Transferrin
(37 Publications)
Species: Hu
Applications: BA
HLA DQ/DR/DP
Antibody (HLA-Pan/296 ...
NBP2-79843
Protein Array: HLA DQ/DR/DP Antibody (HLA-Pan/2967R) - Azide and BSA Free [NBP2-79843] - Analysis of Protein Array containing more than 19,000 full-length human proteins using HLA DQ/DR/DP Antibody (HLA-Pan/2967R). Z- and S- Score: The Z-score represents the strength of a signal that a monoclonal antibody (MAb) (in combination with a fluorescently-tagged anti-IgG secondary antibody) produces when binding to a particular protein on the HuProt(TM) array. Z-scores are described in units of standard deviations (SD's) above the mean value of all signals generated on that array. If targets on HuProt(TM) are arranged in descending order of the Z-score, the S-score is the difference (also in units of SD's) between the Z-score. S-score therefore represents the relative target specificity of a MAb to its intended target. A MAb is considered to specific to its intended target, if the MAb has an S-score of at least 2.5.
Immunocytochemistry/Immunofluorescence: HLA DQ/DR/DP Antibody (HLA-Pan/2967R) - Azide and BSA Free [NBP2-79843] - Immunofluorescence staining of Raji cells using HLA DQ/DR/DP Antibody (HLA-Pan/2967R) followed by goat anti-rabbit IgG-CF488 (Green). Nuclei stained with RedDot (Red).
Western Blot: HLA DQ/DR/DP Antibody (HLA-Pan/2967R) - Azide and BSA Free [NBP2-79843] - Western Blot Analysis of Ramos cell lysate using HLA DQ/DR/DP Antibody (HLA-Pan/2967R).
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, PA, WB
LC3A Antibody -
BSA Free
NB100-2331
Western Blot: LC3A Antibody - BSA Free [NB100-2331] - LC3A Antibody [NB100-2331] - Autophagy mobilized during differentiation of immortalized human mesenchymal stem cells (ihMSCs). Cultured ihMSCs were stimulated to undergo osteogenesis to form osteoblasts for 30 days at 21% and 4% oxygen. LC3I and LC3II levels were assessed via immunoblot every 10 days and normalized to beta-actin to derive average LC3II band densities. Image collected and cropped by CiteAb from the following publication (http://stemcellres.com/content/5/6/140), licensed under a CC-BY licence.
Western Blot: LC3A Antibody - BSA Free [NB100-2331] - LC3A Antibody [NB100-2331] - This LC3A antibody Image shows Analysis in human cell lysates.
Immunocytochemistry/Immunofluorescence: LC3A Antibody - BSA Free [NB100-2331] - LC3A Antibody [NB100-2331] - This LC3A antibody Image shows an analysis in HeLa cells using anti-LC3 antibody (red). Nuclei were counterstained with DAPI (blue).
(22 Reviews)
(279 Publications)
Species: Am, Ca, Fi, Hu, Mu, Pl, Rt, Ze
Applications: ChIP, ELISA, Flow, IB, ICC/IF, IHC-WhMt, IHC, IHC-Fr, IHC-P, IP, Simple Western, SB, WB
CHM Antibody
NBP1-84954
Immunohistochemistry-Paraffin: CHM Antibody [NBP1-84954] - Staining of human cerebellum shows strong positivity in cells in molecular layer.
Immunohistochemistry-Paraffin: CHM Antibody [NBP1-84954] - Staining of human fallopian tube shows moderate cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: CHM Antibody [NBP1-84954] - Staining of human cerebral cortex shows moderate positivity in neurons.
Species: Hu
Applications: IHC, IHC-P
RAB7B Antibody
(1C3)
H00338382-M02
RAB7B Antibody (1C3)
Species: Hu
Applications: WB, ELISA, S-ELISA

Publications for RAB7B Antibody (H00338382-M02) (0)

There are no publications for RAB7B Antibody (H00338382-M02).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RAB7B Antibody (H00338382-M02) (0)

There are no reviews for RAB7B Antibody (H00338382-M02). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for RAB7B Antibody (H00338382-M02) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional RAB7B Products

Bioinformatics Tool for RAB7B Antibody (H00338382-M02)

Discover related pathways, diseases and genes to RAB7B Antibody (H00338382-M02). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RAB7B Antibody (H00338382-M02)

Discover more about diseases related to RAB7B Antibody (H00338382-M02).
 

Pathways for RAB7B Antibody (H00338382-M02)

View related products by pathway.

PTMs for RAB7B Antibody (H00338382-M02)

Learn more about PTMs related to RAB7B Antibody (H00338382-M02).
 

Research Areas for RAB7B Antibody (H00338382-M02)

Find related products by research area.

Blogs on RAB7B

There are no specific blogs for RAB7B, but you can read our latest blog posts.
Download our IHC Handbook

Customers Who Bought This Also Bought

Contact Information

Product PDFs

  PDF Datasheet
  Request CofA
  Request SDS

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our RAB7B Antibody (1C3) and receive a gift card or discount.


Bioinformatics

Gene Symbol RAB7B
Entrez
Uniprot