RAB7B Antibody (1C3)

Images

 
Western Blot: RAB7B Antibody (1C3) [H00338382-M02] - Analysis of RAB7B expression in transfected 293T cell line by RAB7B monoclonal antibody (M02), clone 1C3.Lane 1: RAB7B transfected lysate(22.5 KDa).Lane 2: ...read more
Sandwich ELISA: RAB7B Antibody (1C3) [H00338382-M02] - Detection limit for recombinant GST tagged RAB7B is 0.1 ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, S-ELISA
Clone
1C3
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

RAB7B Antibody (1C3) Summary

Immunogen
RAB7B (NP_796377, 100 a.a. ~ 199 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. DIWRGDVLAKIVPMEQSYPMVLLGNKIDLADRKVPQEVAQGWCREKDIPYFEVSAKNDINVVQAFEMLASRALSRYQSILENHLTESIKLSPDQSRSRCC
Marker
Late Endosome Marker
Specificity
RAB7B - RAB7B, member RAS oncogene family (1C3)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
RAB7B
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
  • Sandwich ELISA
  • Western Blot 1:500
Application Notes
Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for RAB7B Antibody (1C3)

  • MGC16212
  • MGC9726
  • RAB7
  • RAB7B, member RAS oncogene family
  • Ras-related protein Rab-7
  • ras-related protein Rab-7b

Background

Members of the RAB family of RAS related GTP binding proteins are important regulators of vesicular transport and are located in specific intracellular compartments. RAB7 has been localized to late endosomes and shown to be important in the late endocytic pathway. In addition, it has been shown to have a fundamental role in the cellular vacuolation induced by the cytotoxin VacA of Helicobacter pylori.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB120-13253
Species: Bv, Hu, Pm, Mu, Rt
Applications: ICC/IF, IHC-FrFl, IHC, IHC-P, IP, WB
NBP1-91991
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-52721
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-49320
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-83967
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF231
Species: Hu
Applications: CyTOF-ready, ELISA(Cap), ELISA(Det), ELISA(Sta), Flow, ICC, IHC, IP, Simple Western, WB
NBP2-36568
Species: Hu, Mu
Applications: Flow-IC, ICC/IF, IHC, IHC-P, WB
NBP1-87172
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
NBP2-37485
Species: Hu, Pm, Mu, Pm
Applications: CyTOF-ready, ELISA, Flow, IHC, IHC-P, WB
AF1029
Species: Mu
Applications: ICC, IHC, IP, WB
236-EG
Species: Hu
Applications: BA
NBP1-33110
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KO, WB
NBP2-22217
Species: Ch, Hu, Mu, Rt(-)
Applications: CyTOF-ready, ELISA, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, KO, Simple Western, WB
NB100-524
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
7268-CT
Species: Hu
Applications: BA
2914-HT
Species: Hu
Applications: BA
NBP2-79843
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, PA, WB
NB100-2331
Species: Am, Ca, Fi, Hu, Mu, Pl, Rt, Ze
Applications: ChIP, ELISA, Flow, IB, ICC/IF, IHC-WhMt, IHC, IHC-Fr, IHC-P, IP, Simple Western, SB, WB
NBP1-84954
Species: Hu
Applications: IHC, IHC-P
H00338382-M02
Species: Hu
Applications: WB, ELISA, S-ELISA

Publications for RAB7B Antibody (H00338382-M02) (0)

There are no publications for RAB7B Antibody (H00338382-M02).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RAB7B Antibody (H00338382-M02) (0)

There are no reviews for RAB7B Antibody (H00338382-M02). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for RAB7B Antibody (H00338382-M02) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional RAB7B Products

Bioinformatics Tool for RAB7B Antibody (H00338382-M02)

Discover related pathways, diseases and genes to RAB7B Antibody (H00338382-M02). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RAB7B Antibody (H00338382-M02)

Discover more about diseases related to RAB7B Antibody (H00338382-M02).
 

Pathways for RAB7B Antibody (H00338382-M02)

View related products by pathway.

PTMs for RAB7B Antibody (H00338382-M02)

Learn more about PTMs related to RAB7B Antibody (H00338382-M02).
 

Research Areas for RAB7B Antibody (H00338382-M02)

Find related products by research area.

Blogs on RAB7B

There are no specific blogs for RAB7B, but you can read our latest blog posts.
Download our IHC Handbook

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our RAB7B Antibody (1C3) and receive a gift card or discount.

Bioinformatics

Gene Symbol RAB7B
Entrez
Uniprot